mRNA_H-akashiwo_Contig10.45.1 (mRNA) Heterosigma akashiwo CCMP452
Overview
Homology
BLAST of mRNA_H-akashiwo_Contig10.45.1 vs. uniprot
Match: A0A383WPW9_TETOB (RING-type domain-containing protein n=1 Tax=Tetradesmus obliquus TaxID=3088 RepID=A0A383WPW9_TETOB) HSP 1 Score: 61.6 bits (148), Expect = 1.280e-8 Identity = 22/44 (50.00%), Postives = 32/44 (72.73%), Query Frame = 1 Query: 94 TVLVRRLPCQHYFHPSCIEEWLLTQANCPLCKQEVFAPGEAGTA 225 ++ V++LPC+HY+HP CI+ WL+ CPLCK V+AP +A A Sbjct: 196 SIEVKQLPCKHYYHPDCIDAWLVRDNTCPLCKSLVWAPNDAAAA 239
BLAST of mRNA_H-akashiwo_Contig10.45.1 vs. uniprot
Match: A0A433PEZ9_9FUNG (RING-type domain-containing protein (Fragment) n=1 Tax=Jimgerdemannia flammicorona TaxID=994334 RepID=A0A433PEZ9_9FUNG) HSP 1 Score: 61.2 bits (147), Expect = 2.290e-8 Identity = 24/62 (38.71%), Postives = 37/62 (59.68%), Query Frame = 1 Query: 22 DVSKTQVVPVVEDGAVQQVAAGESTVLVRRLPCQHYFHPSCIEEWLLTQANCPLCKQEVFAP 207 D S+ + +++ + E T +R LPC HYFH +CI++WLLT +CPLCK ++ P Sbjct: 217 DESRLDIEDEIDESCAICLGDYEPTEWIRILPCTHYFHKNCIDQWLLTDKSCPLCKHDIDQP 278
BLAST of mRNA_H-akashiwo_Contig10.45.1 vs. uniprot
Match: A0A812Z0E0_9DINO (Rnf38 protein n=1 Tax=Symbiodinium necroappetens TaxID=1628268 RepID=A0A812Z0E0_9DINO) HSP 1 Score: 59.7 bits (143), Expect = 7.700e-8 Identity = 26/43 (60.47%), Postives = 28/43 (65.12%), Query Frame = 1 Query: 100 LVRRLPCQHYFHPSCIEEWLLTQANCPLCKQEVFAPGEAGTAR 228 LVRRLPC H FH SCI+ WL CPLC +EV AP E AR Sbjct: 309 LVRRLPCNHVFHQSCIDRWLRRNQVCPLCLREVKAPSENSLAR 351
BLAST of mRNA_H-akashiwo_Contig10.45.1 vs. uniprot
Match: A0A1Q9ERH3_SYMMI (E3 ubiquitin-protein ligase RNF38 n=3 Tax=Symbiodinium TaxID=2949 RepID=A0A1Q9ERH3_SYMMI) HSP 1 Score: 59.7 bits (143), Expect = 8.610e-8 Identity = 26/43 (60.47%), Postives = 28/43 (65.12%), Query Frame = 1 Query: 100 LVRRLPCQHYFHPSCIEEWLLTQANCPLCKQEVFAPGEAGTAR 228 LVRRLPC H FH SCI+ WL CPLC +EV AP E AR Sbjct: 309 LVRRLPCNHVFHQSCIDRWLRRNQVCPLCLREVKAPSENSLAR 351
BLAST of mRNA_H-akashiwo_Contig10.45.1 vs. uniprot
Match: A0A383VKF5_TETOB (RING-type domain-containing protein n=1 Tax=Tetradesmus obliquus TaxID=3088 RepID=A0A383VKF5_TETOB) HSP 1 Score: 58.5 bits (140), Expect = 2.080e-7 Identity = 20/36 (55.56%), Postives = 27/36 (75.00%), Query Frame = 1 Query: 100 LVRRLPCQHYFHPSCIEEWLLTQANCPLCKQEVFAP 207 L+++LPCQHY+H CI++WL NCPLCK V+ P Sbjct: 344 LLKQLPCQHYYHAQCIDQWLTRSGNCPLCKAAVWQP 379
BLAST of mRNA_H-akashiwo_Contig10.45.1 vs. uniprot
Match: A0A7S2SC38_9STRA (Hypothetical protein n=1 Tax=Rhizochromulina marina TaxID=1034831 RepID=A0A7S2SC38_9STRA) HSP 1 Score: 58.2 bits (139), Expect = 2.710e-7 Identity = 28/72 (38.89%), Postives = 42/72 (58.33%), Query Frame = 1 Query: 88 ESTVLVRRLPCQHYFHPSCIEEWLLTQANCPLCKQEVFAP-GEAGTARDGQRESQQGLLEEGEPVRPSAASS 300 E + VR LPC+H+FHP C++EWL + CP C+ ++ +P GE G R S G +G + P+A+ S Sbjct: 277 EKDMEVRVLPCKHFFHPQCVDEWLRLNSTCPSCRLDITSPPGEQG------RRSDSGADRDGIELAPTASQS 342
BLAST of mRNA_H-akashiwo_Contig10.45.1 vs. uniprot
Match: A0A0D9P6F8_METAN (RING-type domain-containing protein n=5 Tax=Metarhizium TaxID=5529 RepID=A0A0D9P6F8_METAN) HSP 1 Score: 56.6 bits (135), Expect = 2.890e-7 Identity = 23/35 (65.71%), Postives = 26/35 (74.29%), Query Frame = 1 Query: 100 LVRRLPCQHYFHPSCIEEWLLTQAN-CPLCKQEVF 201 +VRRLPCQHYFH SC++ W L Q N CPLCK F Sbjct: 116 MVRRLPCQHYFHSSCLDTWYLRQHNTCPLCKTPFF 150
BLAST of mRNA_H-akashiwo_Contig10.45.1 vs. uniprot
Match: A0A7S0QVM1_9CHLO (Hypothetical protein (Fragment) n=1 Tax=Pyramimonas obovata TaxID=1411642 RepID=A0A7S0QVM1_9CHLO) HSP 1 Score: 55.1 bits (131), Expect = 4.180e-7 Identity = 27/74 (36.49%), Postives = 43/74 (58.11%), Query Frame = 1 Query: 10 PSRSDVSKTQVVPVVE-DGAVQQVAAGESTVL----------VRRLPCQHYFHPSCIEEWLLTQANCPLCKQEV 198 P R S+ + +PVVE +GA + E + +RRLPC+H+FH +CI+EWL ++ CP+CK ++ Sbjct: 41 PHRLTPSEVKAIPVVEYEGAEEGEEGAELCTICLDDFAKGDQLRRLPCRHHFHVTCIDEWLGRRSMCPVCKHDL 114
BLAST of mRNA_H-akashiwo_Contig10.45.1 vs. uniprot
Match: A0A482RN29_9ARCH (RING-type domain-containing protein n=1 Tax=archaeon TaxID=1906665 RepID=A0A482RN29_9ARCH) HSP 1 Score: 55.1 bits (131), Expect = 5.410e-7 Identity = 24/41 (58.54%), Postives = 30/41 (73.17%), Query Frame = 1 Query: 82 AGESTVLVRRLPCQHYFHPSCIEEWLLTQANCPLCKQEVFA 204 AGE LVR LPC H+FH +CI++WL +A CPLCK +V A Sbjct: 85 AGE---LVRPLPCCHFFHAACIDQWLAERAVCPLCKVDVLA 122
BLAST of mRNA_H-akashiwo_Contig10.45.1 vs. uniprot
Match: A0A179G9M8_METCM (Ring finger domain-containing protein n=1 Tax=Pochonia chlamydosporia 170 TaxID=1380566 RepID=A0A179G9M8_METCM) HSP 1 Score: 54.3 bits (129), Expect = 6.390e-7 Identity = 21/35 (60.00%), Postives = 25/35 (71.43%), Query Frame = 1 Query: 100 LVRRLPCQHYFHPSCIEEWLLTQ-ANCPLCKQEVF 201 +VR LPCQHYFH SC++ W L Q CPLCK +F Sbjct: 51 MVRHLPCQHYFHSSCLDTWYLRQHQTCPLCKTPIF 85 The following BLAST results are available for this feature:
BLAST of mRNA_H-akashiwo_Contig10.45.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 25
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following UTR feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_H-akashiwo_Contig10.45.1 >prot_H-akashiwo_Contig10.45.1 ID=prot_H-akashiwo_Contig10.45.1|Name=mRNA_H-akashiwo_Contig10.45.1|organism=Heterosigma akashiwo CCMP452|type=polypeptide|length=131bp RSSPSRSDVSKTQVVPVVEDGAVQQVAAGESTVLVRRLPCQHYFHPSCIEback to top mRNA from alignment at H-akashiwo_Contig10:2201785..2202180+ Legend: CDSpolypeptideUTR Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_H-akashiwo_Contig10.45.1 ID=mRNA_H-akashiwo_Contig10.45.1|Name=mRNA_H-akashiwo_Contig10.45.1|organism=Heterosigma akashiwo CCMP452|type=mRNA|length=396bp|location=Sequence derived from alignment at H-akashiwo_Contig10:2201785..2202180+ (Heterosigma akashiwo CCMP452)back to top Coding sequence (CDS) from alignment at H-akashiwo_Contig10:2201785..2202180+ >mRNA_H-akashiwo_Contig10.45.1 ID=mRNA_H-akashiwo_Contig10.45.1|Name=mRNA_H-akashiwo_Contig10.45.1|organism=Heterosigma akashiwo CCMP452|type=CDS|length=393bp|location=Sequence derived from alignment at H-akashiwo_Contig10:2201785..2202180+ (Heterosigma akashiwo CCMP452)back to top |