mRNA_H-akashiwo_Contig10.127.1 (mRNA) Heterosigma akashiwo CCMP452
Overview
Homology
BLAST of mRNA_H-akashiwo_Contig10.127.1 vs. uniprot
Match: A0A3M6V6M0_9STRA (Uncharacterized protein n=2 Tax=Peronospora effusa TaxID=542832 RepID=A0A3M6V6M0_9STRA) HSP 1 Score: 63.5 bits (153), Expect = 1.060e-10 Identity = 29/47 (61.70%), Postives = 31/47 (65.96%), Query Frame = 1 Query: 1 AHCAPCNLRLRVHFPIIVPTSSTLGENERPSCGIRVADELRHWEEGK 141 AH APCN+RLR HFP+IVP CGIRV DE RHWEEGK Sbjct: 178 AHSAPCNIRLRCHFPLIVPEG----------CGIRVGDETRHWEEGK 214
BLAST of mRNA_H-akashiwo_Contig10.127.1 vs. uniprot
Match: M4B2W2_HYAAE (Asp_Arg_Hydrox domain-containing protein n=1 Tax=Hyaloperonospora arabidopsidis (strain Emoy2) TaxID=559515 RepID=M4B2W2_HYAAE) HSP 1 Score: 60.5 bits (145), Expect = 3.180e-10 Identity = 28/47 (59.57%), Postives = 30/47 (63.83%), Query Frame = 1 Query: 1 AHCAPCNLRLRVHFPIIVPTSSTLGENERPSCGIRVADELRHWEEGK 141 AH APCN+RLR HFPI+VP CGIRV DE R WEEGK Sbjct: 54 AHSAPCNIRLRCHFPILVPDG----------CGIRVGDETRQWEEGK 90
BLAST of mRNA_H-akashiwo_Contig10.127.1 vs. uniprot
Match: A0A8K1C3S3_PYTOL (Uncharacterized protein n=1 Tax=Pythium oligandrum TaxID=41045 RepID=A0A8K1C3S3_PYTOL) HSP 1 Score: 61.6 bits (148), Expect = 4.290e-10 Identity = 28/47 (59.57%), Postives = 30/47 (63.83%), Query Frame = 1 Query: 1 AHCAPCNLRLRVHFPIIVPTSSTLGENERPSCGIRVADELRHWEEGK 141 AH APCN+RLR HFP+ VP CGIRV DE RHWEEGK Sbjct: 148 AHSAPCNVRLRCHFPLFVPEG----------CGIRVGDETRHWEEGK 184
BLAST of mRNA_H-akashiwo_Contig10.127.1 vs. uniprot
Match: A0A7S2A714_9STRA (Hypothetical protein n=1 Tax=Ditylum brightwellii TaxID=49249 RepID=A0A7S2A714_9STRA) HSP 1 Score: 59.7 bits (143), Expect = 6.690e-10 Identity = 26/47 (55.32%), Postives = 32/47 (68.09%), Query Frame = 1 Query: 4 HCAPCNLRLRVHFPIIVPTSSTLGE-NERPSCGIRVADELRHWEEGK 141 H P NLRLRVH P+IVPT+ NERP CGIRV ++ W+EG+ Sbjct: 51 HTGPMNLRLRVHLPLIVPTTDGKNNGNERPKCGIRVGSKIHEWKEGE 97
BLAST of mRNA_H-akashiwo_Contig10.127.1 vs. uniprot
Match: W2RER7_PHYPN (Asp_Arg_Hydrox domain-containing protein n=8 Tax=Phytophthora parasitica TaxID=4792 RepID=W2RER7_PHYPN) HSP 1 Score: 60.5 bits (145), Expect = 8.060e-10 Identity = 28/47 (59.57%), Postives = 30/47 (63.83%), Query Frame = 1 Query: 1 AHCAPCNLRLRVHFPIIVPTSSTLGENERPSCGIRVADELRHWEEGK 141 AH APCN+RLR HFP+IVP CGIRV DE R WEEGK Sbjct: 151 AHSAPCNIRLRCHFPLIVPEG----------CGIRVGDETRQWEEGK 187
BLAST of mRNA_H-akashiwo_Contig10.127.1 vs. uniprot
Match: A0A3R7K0G3_9STRA (Asp_Arg_Hydrox domain-containing protein n=2 Tax=Phytophthora kernoviae TaxID=325452 RepID=A0A3R7K0G3_9STRA) HSP 1 Score: 58.9 bits (141), Expect = 1.870e-9 Identity = 27/47 (57.45%), Postives = 29/47 (61.70%), Query Frame = 1 Query: 1 AHCAPCNLRLRVHFPIIVPTSSTLGENERPSCGIRVADELRHWEEGK 141 AH APCN+RLR HFP+ VP CGIRV DE R WEEGK Sbjct: 78 AHSAPCNIRLRCHFPLFVPEG----------CGIRVGDETRQWEEGK 114
BLAST of mRNA_H-akashiwo_Contig10.127.1 vs. uniprot
Match: A0A067C8Q3_SAPPC (Asp_Arg_Hydrox domain-containing protein n=3 Tax=Saprolegniaceae TaxID=4764 RepID=A0A067C8Q3_SAPPC) HSP 1 Score: 59.7 bits (143), Expect = 2.000e-9 Identity = 26/47 (55.32%), Postives = 32/47 (68.09%), Query Frame = 1 Query: 1 AHCAPCNLRLRVHFPIIVPTSSTLGENERPSCGIRVADELRHWEEGK 141 AH APCN+RLR HFP+ VP P+CGIRVADE + W+EG+ Sbjct: 138 AHSAPCNIRLRCHFPLFVP----------PNCGIRVADETKEWKEGE 174
BLAST of mRNA_H-akashiwo_Contig10.127.1 vs. uniprot
Match: A0A6A5A8Y7_9STRA (Asp_Arg_Hydrox domain-containing protein (Fragment) n=1 Tax=Aphanomyces astaci TaxID=112090 RepID=A0A6A5A8Y7_9STRA) HSP 1 Score: 58.9 bits (141), Expect = 2.280e-9 Identity = 26/47 (55.32%), Postives = 31/47 (65.96%), Query Frame = 1 Query: 1 AHCAPCNLRLRVHFPIIVPTSSTLGENERPSCGIRVADELRHWEEGK 141 AH APCN+RLR HFP+ VP P CGIRVAD+ R W+EG+ Sbjct: 144 AHSAPCNIRLRCHFPLFVP----------PGCGIRVADQTRSWKEGE 180
BLAST of mRNA_H-akashiwo_Contig10.127.1 vs. uniprot
Match: A0A836CPE8_9STRA (Putative aspartyl/Asparaginyl beta-hydroxylase n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A836CPE8_9STRA) HSP 1 Score: 59.3 bits (142), Expect = 3.110e-9 Identity = 27/46 (58.70%), Postives = 32/46 (69.57%), Query Frame = 1 Query: 4 HCAPCNLRLRVHFPIIVPTSSTLGENERPSCGIRVADELRHWEEGK 141 H A CNLRLR HFP+IVP+++ CGIRV DE+R WEEGK Sbjct: 149 HTAACNLRLRCHFPLIVPSTNA------DECGIRVGDEVRAWEEGK 188
BLAST of mRNA_H-akashiwo_Contig10.127.1 vs. uniprot
Match: A0A6A3EN18_9STRA (Asp_Arg_Hydrox domain-containing protein n=2 Tax=Phytophthora TaxID=4783 RepID=A0A6A3EN18_9STRA) HSP 1 Score: 58.9 bits (141), Expect = 3.410e-9 Identity = 27/47 (57.45%), Postives = 29/47 (61.70%), Query Frame = 1 Query: 1 AHCAPCNLRLRVHFPIIVPTSSTLGENERPSCGIRVADELRHWEEGK 141 AH APCN+RLR HFP+ VP CGIRV DE R WEEGK Sbjct: 147 AHSAPCNIRLRCHFPLFVPEG----------CGIRVGDETRQWEEGK 183 The following BLAST results are available for this feature:
BLAST of mRNA_H-akashiwo_Contig10.127.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 25
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_H-akashiwo_Contig10.127.1 >prot_H-akashiwo_Contig10.127.1 ID=prot_H-akashiwo_Contig10.127.1|Name=mRNA_H-akashiwo_Contig10.127.1|organism=Heterosigma akashiwo CCMP452|type=polypeptide|length=48bp AHCAPCNLRLRVHFPIIVPTSSTLGENERPSCGIRVADELRHWEEGKTback to top mRNA from alignment at H-akashiwo_Contig10:5707799..5709569- Legend: polypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_H-akashiwo_Contig10.127.1 ID=mRNA_H-akashiwo_Contig10.127.1|Name=mRNA_H-akashiwo_Contig10.127.1|organism=Heterosigma akashiwo CCMP452|type=mRNA|length=1771bp|location=Sequence derived from alignment at H-akashiwo_Contig10:5707799..5709569- (Heterosigma akashiwo CCMP452)back to top Coding sequence (CDS) from alignment at H-akashiwo_Contig10:5707799..5709569- >mRNA_H-akashiwo_Contig10.127.1 ID=mRNA_H-akashiwo_Contig10.127.1|Name=mRNA_H-akashiwo_Contig10.127.1|organism=Heterosigma akashiwo CCMP452|type=CDS|length=144bp|location=Sequence derived from alignment at H-akashiwo_Contig10:5707799..5709569- (Heterosigma akashiwo CCMP452)back to top |