mRNA_H-akashiwo_Contig10.119.1 (mRNA) Heterosigma akashiwo CCMP452
Overview
Homology
BLAST of mRNA_H-akashiwo_Contig10.119.1 vs. uniprot
Match: A0A7R9Y919_9STRA (Hypothetical protein (Fragment) n=1 Tax=Pinguiococcus pyrenoidosus TaxID=172671 RepID=A0A7R9Y919_9STRA) HSP 1 Score: 81.3 bits (199), Expect = 2.660e-15 Identity = 42/96 (43.75%), Postives = 59/96 (61.46%), Query Frame = 3 Query: 354 LPDFTLKEVAKVAPTLQFNIDYYLFEFKAIVEDPTKWGDMLDAFRASSDARFASVSRFERDFYTPMRNLGQAFPEEQGGDELLAAARGLEGAAARL 641 LP + K + A L F +D Y+F+ +ED TKW D+L ++SSDARF SVSR ERD +P+R+L Q PE+ GG ++ A GL + A+L Sbjct: 36 LPPQSQKVLVSNAQRLVFAVDAYVFDLAEDLEDTTKWADVLGQLQSSSDARFVSVSRIERDVISPLRSLSQGLPEDAGGADIDEAVNGLVVSMAKL 131
BLAST of mRNA_H-akashiwo_Contig10.119.1 vs. uniprot
Match: A0A0G4G2V7_VITBC (Uncharacterized protein n=1 Tax=Vitrella brassicaformis (strain CCMP3155) TaxID=1169540 RepID=A0A0G4G2V7_VITBC) HSP 1 Score: 79.3 bits (194), Expect = 3.980e-14 Identity = 45/120 (37.50%), Postives = 69/120 (57.50%), Query Frame = 3 Query: 294 FQEKASAFSPLMMADED---DLPLPDFTLKEVAKVAPTLQFNIDYYLFEFKAIVEDPTKWGDMLDAFRASSDARFASVSRFERDFYTPMRNLGQAFPEEQGGDELLAAARGLEGAAARLE 644 F A A S ++ D+ + PLP ++K + AP LQ + D+YLF+ + + W D+LD F+ S ARF SVSR +RDF++PMR L ++ PE++GG +L E + RL+ Sbjct: 70 FPAAALAVSNALLLDDAVAVEPPLPS-SIKSFRQYAPQLQLSGDFYLFDLAEDIRT-SNWDDVLDQFKVSGSARFVSVSRMDRDFFSPMRLLAKSVPEDEGGSDLEQVTERFESSMRRLQ 187 The following BLAST results are available for this feature:
BLAST of mRNA_H-akashiwo_Contig10.119.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_H-akashiwo_Contig10.119.1 >prot_H-akashiwo_Contig10.119.1 ID=prot_H-akashiwo_Contig10.119.1|Name=mRNA_H-akashiwo_Contig10.119.1|organism=Heterosigma akashiwo CCMP452|type=polypeptide|length=190bp MNSKCYIFLYVGLWASASSCAFQVSSNSHNGAVLRMMAMDGSPGEGNILQback to top mRNA from alignment at H-akashiwo_Contig10:5374249..5374895+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_H-akashiwo_Contig10.119.1 ID=mRNA_H-akashiwo_Contig10.119.1|Name=mRNA_H-akashiwo_Contig10.119.1|organism=Heterosigma akashiwo CCMP452|type=mRNA|length=647bp|location=Sequence derived from alignment at H-akashiwo_Contig10:5374249..5374895+ (Heterosigma akashiwo CCMP452)back to top Coding sequence (CDS) from alignment at H-akashiwo_Contig10:5374249..5374895+ >mRNA_H-akashiwo_Contig10.119.1 ID=mRNA_H-akashiwo_Contig10.119.1|Name=mRNA_H-akashiwo_Contig10.119.1|organism=Heterosigma akashiwo CCMP452|type=CDS|length=570bp|location=Sequence derived from alignment at H-akashiwo_Contig10:5374249..5374895+ (Heterosigma akashiwo CCMP452)back to top |