Homology
The following BLAST results are available for this feature:
BLAST of mRNA_H-fluviatilis_contig100984.267.1 vs. uniprot
Analysis Date: 2022-09-16 ( Diamond blastp: OGS1.0 vs UniRef90)
Total hits: 0
Match Name | E-value | Identity | Description | |
back to top
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
IPR Term | IPR Description | Source | Source Term | Source Description | Alignment |
None | No IPR available | PFAM | PF13637 | Ank_4 | coord: 38..71 e-value: 1.9E-5 score: 25.1 |
IPR036770 | Ankyrin repeat-containing domain superfamily | GENE3D | 1.25.40.20 | | coord: 2..84 e-value: 4.3E-10 score: 41.4 |
IPR036770 | Ankyrin repeat-containing domain superfamily | SUPERFAMILY | 48403 | Ankyrin repeat | coord: 35..73 |
IPR020683 | Ankyrin repeat-containing domain | PROSITE | PS50297 | ANK_REP_REGION | coord: 42..71 score: 8.694 |
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_H-fluviatilis_contig100984.267.1 ID=prot_H-fluviatilis_contig100984.267.1|Name=mRNA_H-fluviatilis_contig100984.267.1|organism=Heribaudiella fluviatilis SAG_13_90|type=polypeptide|length=85bp CAHSVKESATPAAAVTAEQFLEASETGDLATLLRGLAQYPPVDINAVDKA GCTALHTAVWRKDARMVSLLLAQPPPNAIRVDARH back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: INTERPRO
Term | Definition |
IPR036770 | Ankyrin_rpt-contain_sf |
IPR020683 | Ankyrin_rpt-contain_dom |
|