Homology
The following BLAST results are available for this feature:
BLAST of mRNA_H-fluviatilis_contig100046.71.1 vs. uniprot
Analysis Date: 2022-09-16 ( Diamond blastp: OGS1.0 vs UniRef90)
Total hits: 0
Match Name | E-value | Identity | Description | |
back to top
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
IPR Term | IPR Description | Source | Source Term | Source Description | Alignment |
IPR013083 | Zinc finger, RING/FYVE/PHD-type | GENE3D | 3.30.40.10 | | coord: 56..100 e-value: 6.6E-7 score: 31.5 coord: 1..55 e-value: 7.0E-5 score: 25.0 |
IPR001293 | Zinc finger, TRAF-type | PFAM | PF02176 | zf-TRAF | coord: 1..46 e-value: 9.8E-5 score: 23.0 |
IPR008974 | TRAF-like | SUPERFAMILY | 49599 | TRAF domain-like | coord: 6..93 |
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_H-fluviatilis_contig100046.71.1 ID=prot_H-fluviatilis_contig100046.71.1|Name=mRNA_H-fluviatilis_contig100046.71.1|organism=Heribaudiella fluviatilis SAG_13_90|type=polypeptide|length=100bp CPLTSVRCRLGCGANMWLKMRTEHESLLCSELTVTCKWGCAEAIKGVFLP LPTECSTVRGFRQCGNRCGQTVPVADMKTHYAEACPHRFVPCGAGCGYKI back to top
Annotated Terms
The following terms have been associated with this polypeptide:
|