prot_H-canaliculatus_F_contig10073.104.1 (polypeptide) Hapterophycus canaliculatus Oshoro5f female
Overview
Homology
BLAST of mRNA_H-canaliculatus_F_contig10073.104.1 vs. uniprot
Match: D8LQV5_ECTSI (Acyltransferase n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LQV5_ECTSI) HSP 1 Score: 63.9 bits (154), Expect = 2.190e-10 Identity = 31/35 (88.57%), Postives = 31/35 (88.57%), Query Frame = 0 Query: 1 MGAEERAGSPVTTTYRSLRGVFTAGLKGFYNTVEV 35 M AE R GSPVT TYRSLRGVFTAGLKGFYNTVEV Sbjct: 1 MAAERRRGSPVTYTYRSLRGVFTAGLKGFYNTVEV 35 The following BLAST results are available for this feature:
BLAST of mRNA_H-canaliculatus_F_contig10073.104.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Hapterophycus canaliculatus Oshoro5f female vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_H-canaliculatus_F_contig10073.104.1 ID=prot_H-canaliculatus_F_contig10073.104.1|Name=mRNA_H-canaliculatus_F_contig10073.104.1|organism=Hapterophycus canaliculatus Oshoro5f female|type=polypeptide|length=62bpback to top |