Homology
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterProScan on OGS1.0 of Hapterophycus canaliculatus Oshoro5f female
Date Performed: 2022-09-29
IPR Term | IPR Description | Source | Source Term | Source Description | Alignment |
None | No IPR available | PHOBIUS | TRANSMEMBRANE | Transmembrane region | coord: 128..154 |
None | No IPR available | PHOBIUS | NON_CYTOPLASMIC_DOMAIN | Non cytoplasmic domain | coord: 1..127 |
None | No IPR available | PHOBIUS | CYTOPLASMIC_DOMAIN | Cytoplasmic domain | coord: 155..158 |
None | No IPR available | TMHMM | TMhelix | | coord: 127..149 |
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_H-canaliculatus_F_contig10121.151.1 ID=prot_H-canaliculatus_F_contig10121.151.1|Name=mRNA_H-canaliculatus_F_contig10121.151.1|organism=Hapterophycus canaliculatus Oshoro5f female|type=polypeptide|length=159bp RCRRLSSTRSVFCSSRFSKKRYFVFQGAWCRDTALGPCAVGRRRKPCVRG FVLVPPRGFGTTVFCCPFSCCRPPHRVTTYLCHAASAHPVLPLVCCKTRH VDATDASIVGAGCTSWRRCGISNAPPPLISPACLCLLATLLPLVLLIPSC VRLFSCLR* back to top
|