prot_H-canaliculatus_F_contig1008.108.1 (polypeptide) Hapterophycus canaliculatus Oshoro5f female
Overview
Homology
BLAST of mRNA_H-canaliculatus_F_contig1008.108.1 vs. uniprot
Match: A0A6H5KYM5_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KYM5_9PHAE) HSP 1 Score: 136 bits (343), Expect = 4.120e-40 Identity = 63/84 (75.00%), Postives = 71/84 (84.52%), Query Frame = 0 Query: 15 MMLVGMADIVVTSPRSSFSALASASGGESTQRFGGISCNPLVNDPEFHSLECAKNEWRVDQVGNPKQWDAVYHLVDSNAKRCKG 98 MMLVG ADI VTSPRSS+SALA+A GG STQR+GGISC VN+PEFH LECAKNEW+VDQV NP +WD +YHLV+SN RCKG Sbjct: 1 MMLVGNADIAVTSPRSSYSALAAARGGSSTQRYGGISCTEQVNEPEFHCLECAKNEWKVDQVKNPTEWDNIYHLVESNRARCKG 84 The following BLAST results are available for this feature:
BLAST of mRNA_H-canaliculatus_F_contig1008.108.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Hapterophycus canaliculatus Oshoro5f female vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_H-canaliculatus_F_contig1008.108.1 ID=prot_H-canaliculatus_F_contig1008.108.1|Name=mRNA_H-canaliculatus_F_contig1008.108.1|organism=Hapterophycus canaliculatus Oshoro5f female|type=polypeptide|length=99bpback to top |