prot_H-canaliculatus_F_contig10071.101.1 (polypeptide) Hapterophycus canaliculatus Oshoro5f female
Overview
Homology
BLAST of mRNA_H-canaliculatus_F_contig10071.101.1 vs. uniprot
Match: A0A388JRW7_CHABU (Uncharacterized protein n=2 Tax=Chara braunii TaxID=69332 RepID=A0A388JRW7_CHABU) HSP 1 Score: 52.0 bits (123), Expect = 3.050e-6 Identity = 23/54 (42.59%), Postives = 34/54 (62.96%), Query Frame = 0 Query: 4 KKLYQASLLRAVKKTAGEGLFPLFLVDSPHYSRRDLEDVWGAAKRAGFEAYVVD 57 +++Y+AS+ +A KKT EG F +VD + D W AAKR+G+E YV+D Sbjct: 1211 EEVYKASMFKAFKKTLEEGRFTFIIVDDRNVLVADFSQYWAAAKRSGYEVYVLD 1264 The following BLAST results are available for this feature:
BLAST of mRNA_H-canaliculatus_F_contig10071.101.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Hapterophycus canaliculatus Oshoro5f female vs UniRef90) Total hits: 1
InterPro
Analysis Name: InterProScan on OGS1.0 of Hapterophycus canaliculatus Oshoro5f female
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_H-canaliculatus_F_contig10071.101.1 ID=prot_H-canaliculatus_F_contig10071.101.1|Name=mRNA_H-canaliculatus_F_contig10071.101.1|organism=Hapterophycus canaliculatus Oshoro5f female|type=polypeptide|length=58bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|