mRNA_H-canaliculatus_F_contig10304.323.1 (mRNA) Hapterophycus canaliculatus Oshoro5f female
Overview
Homology
BLAST of mRNA_H-canaliculatus_F_contig10304.323.1 vs. uniprot
Match: A0A6H5JBA3_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JBA3_9PHAE) HSP 1 Score: 77.8 bits (190), Expect = 3.040e-14 Identity = 41/84 (48.81%), Postives = 57/84 (67.86%), Query Frame = -1 Query: 141 YRSWHTGEDG-RIVKDRENGIGEGELQSMHHAWQASRRLHSQRRGSVEGTK-------RMEIMSVDTDVWVAALMVYAVHESTR 368 Y+SW+ DG I ++++NG+GEGELQ++HH +Q + S R GS EG + R+E++SVDTDVWVAAL+ YA H TR Sbjct: 447 YKSWYNDVDGAEIPEEKDNGLGEGELQALHHVYQVCLQQQS-REGSREGQEAGVREPVRVEVVSVDTDVWVAALLAYAAHPWTR 529
BLAST of mRNA_H-canaliculatus_F_contig10304.323.1 vs. uniprot
Match: A0A6H5KQE5_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KQE5_9PHAE) HSP 1 Score: 77.8 bits (190), Expect = 3.120e-14 Identity = 41/84 (48.81%), Postives = 57/84 (67.86%), Query Frame = -1 Query: 141 YRSWHTGEDG-RIVKDRENGIGEGELQSMHHAWQASRRLHSQRRGSVEGTK-------RMEIMSVDTDVWVAALMVYAVHESTR 368 Y+SW+ DG I ++++NG+GEGELQ++HH +Q + S R GS EG + R+E++SVDTDVWVAAL+ YA H TR Sbjct: 941 YKSWYNDVDGAEIPEEKDNGLGEGELQALHHVYQVCLQQQS-REGSREGQEAGVREPVRVEVVSVDTDVWVAALLAYAAHPWTR 1023
BLAST of mRNA_H-canaliculatus_F_contig10304.323.1 vs. uniprot
Match: A0A6H5KRV8_9PHAE (Uncharacterized protein (Fragment) n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KRV8_9PHAE) HSP 1 Score: 67.8 bits (164), Expect = 9.830e-11 Identity = 38/88 (43.18%), Postives = 51/88 (57.95%), Query Frame = -1 Query: 141 YRSWHTGEDGRIVKDRENGIGEGELQSMHHAWQASRRLHSQR-------RGSV-----EGTKRMEIMSVDTDVWVAALMVYAVHESTR 368 Y SW+ ++ I+ NGIGEGELQ++HHA+ + R G V E +E++SVDTDVW+AAL+ YAVH STR Sbjct: 838 YLSWYNTKELDIILLEANGIGEGELQALHHAYMTGKNNKESRGQGGEVREGGVVVPTSEDPVTVEVVSVDTDVWMAALLAYAVHPSTR 925
BLAST of mRNA_H-canaliculatus_F_contig10304.323.1 vs. uniprot
Match: A0A6H5KUZ3_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KUZ3_9PHAE) HSP 1 Score: 65.1 bits (157), Expect = 8.310e-10 Identity = 35/89 (39.33%), Postives = 50/89 (56.18%), Query Frame = -1 Query: 141 YRSWHTGEDGRIVKDRENGIGEGELQSMHHAWQASRRLH--------SQRRGSVEGTK-----RMEIMSVDTDVWVAALMVYAVHESTR 368 ++SWH +D I+ D NGIGEGELQ++HHA+ R S + EG R+E++S+ DVWVAAL+ YA++ R Sbjct: 224 FKSWHNDKDSLIIGDEGNGIGEGELQALHHAYLVGRTAGPLTGEGGGSSSENNQEGQGETPPVRVEVVSIHRDVWVAALLAYALYPHIR 312 The following BLAST results are available for this feature:
BLAST of mRNA_H-canaliculatus_F_contig10304.323.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Hapterophycus canaliculatus Oshoro5f female vs UniRef90) Total hits: 4
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following polypeptide feature(s) derives from this mRNA:
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_H-canaliculatus_F_contig10304.323.1 >prot_H-canaliculatus_F_contig10304.323.1 ID=prot_H-canaliculatus_F_contig10304.323.1|Name=mRNA_H-canaliculatus_F_contig10304.323.1|organism=Hapterophycus canaliculatus Oshoro5f female|type=polypeptide|length=96bp MVGHISRRGPRCCRAIMRTFSCRFVHGVHHKRRNPHVRVHRHDLHPFGALback to top mRNA from alignment at H-canaliculatus_F_contig10304:1357..4423+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_H-canaliculatus_F_contig10304.323.1 ID=mRNA_H-canaliculatus_F_contig10304.323.1|Name=mRNA_H-canaliculatus_F_contig10304.323.1|organism=Hapterophycus canaliculatus Oshoro5f female|type=mRNA|length=3067bp|location=Sequence derived from alignment at H-canaliculatus_F_contig10304:1357..4423+ (Hapterophycus canaliculatus Oshoro5f female)back to top Coding sequence (CDS) from alignment at H-canaliculatus_F_contig10304:1357..4423+ >mRNA_H-canaliculatus_F_contig10304.323.1 ID=mRNA_H-canaliculatus_F_contig10304.323.1|Name=mRNA_H-canaliculatus_F_contig10304.323.1|organism=Hapterophycus canaliculatus Oshoro5f female|type=CDS|length=576bp|location=Sequence derived from alignment at H-canaliculatus_F_contig10304:1357..4423+ (Hapterophycus canaliculatus Oshoro5f female)back to top |