mRNA_H-canaliculatus_F_contig10252.264.1 (mRNA) Hapterophycus canaliculatus Oshoro5f female
Overview
Homology
BLAST of mRNA_H-canaliculatus_F_contig10252.264.1 vs. uniprot
Match: D7G334_ECTSI (Metallophos domain-containing protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G334_ECTSI) HSP 1 Score: 102 bits (254), Expect = 1.900e-23 Identity = 50/56 (89.29%), Postives = 50/56 (89.29%), Query Frame = -1 Query: 245 DTDTSEAIDMRSVVTSSCCAPLGPDPPGFRVVRVFSRSIEHEYHSIDAPPQHIDLG 412 DTDTSEAIDMRSVVTSS APLGPDPPGFRVVRVFSR IEHEY IDAPPQ IDLG Sbjct: 276 DTDTSEAIDMRSVVTSSSGAPLGPDPPGFRVVRVFSRRIEHEYFDIDAPPQGIDLG 331
BLAST of mRNA_H-canaliculatus_F_contig10252.264.1 vs. uniprot
Match: A0A835ZFF7_9STRA (Kinase-like domain-containing protein n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A835ZFF7_9STRA) HSP 1 Score: 65.9 bits (159), Expect = 7.620e-10 Identity = 28/56 (50.00%), Postives = 37/56 (66.07%), Query Frame = -1 Query: 230 EAIDMRSVVTSSCCAPLGPDPPGFRVVRVFSRSIEHEYHSIDAPPQHIDLGEEP*P 397 E ++M+ + TSS PLGPDP G R+VRVF IEHEYH++ P+ + L EP P Sbjct: 953 ERVEMQHITTSSVTYPLGPDPVGLRLVRVFDDRIEHEYHALSEVPESVTLEAEPRP 1008
BLAST of mRNA_H-canaliculatus_F_contig10252.264.1 vs. uniprot
Match: A0A6M1ZW31_9BACT (3',5'-cyclic adenosine monophosphate phosphodiesterase CpdA n=1 Tax=Chlamydiae bacterium TaxID=2081524 RepID=A0A6M1ZW31_9BACT) HSP 1 Score: 54.7 bits (130), Expect = 4.640e-6 Identity = 23/49 (46.94%), Postives = 30/49 (61.22%), Query Frame = -1 Query: 239 MRSVVTSSCCAPLGPDPPGFRVVRVFSRSIEHEYHSIDAPPQHIDLGEE 385 M V TS+ P+G DP GFR+V+VF +EHEY ID P+ + L E Sbjct: 263 MEVVTTSALGKPIGKDPSGFRIVKVFEDRVEHEYFGIDEVPESVSLQSE 311
BLAST of mRNA_H-canaliculatus_F_contig10252.264.1 vs. uniprot
Match: A0A382CZ84_9ZZZZ (Metallophos domain-containing protein n=1 Tax=marine metagenome TaxID=408172 RepID=A0A382CZ84_9ZZZZ) HSP 1 Score: 53.5 bits (127), Expect = 1.100e-5 Identity = 22/53 (41.51%), Postives = 33/53 (62.26%), Query Frame = -1 Query: 239 EAIDMRSVVTSSCCAPLGPDPPGFRVVRVFSRSIEHEYHSIDAPPQHIDLGEE 397 E D++ + T PLG DP GFR+VRV+ S+ H Y+S+D P +++ EE Sbjct: 233 EYNDIKMITTGPVGKPLGDDPSGFRIVRVYPDSMRHLYYSLDEVPDEVNVDEE 285
BLAST of mRNA_H-canaliculatus_F_contig10252.264.1 vs. uniprot
Match: X1IE94_9ZZZZ (Uncharacterized protein (Fragment) n=1 Tax=marine sediment metagenome TaxID=412755 RepID=X1IE94_9ZZZZ) HSP 1 Score: 49.3 bits (116), Expect = 6.850e-5 Identity = 21/47 (44.68%), Postives = 31/47 (65.96%), Query Frame = -1 Query: 248 DMRSVVTSSCCAPLGPDPPGFRVVRVFSRSIEHEYHSIDAPPQHIDL 388 ++ V TSS PLG DP GFR+V+V+ IEH+Y+S P+ ++L Sbjct: 59 ELELVTTSSSGKPLGEDPIGFRIVKVYPDRIEHKYYSYKEMPKKVNL 105 The following BLAST results are available for this feature:
BLAST of mRNA_H-canaliculatus_F_contig10252.264.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Hapterophycus canaliculatus Oshoro5f female vs UniRef90) Total hits: 5
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_H-canaliculatus_F_contig10252.264.1 >prot_H-canaliculatus_F_contig10252.264.1 ID=prot_H-canaliculatus_F_contig10252.264.1|Name=mRNA_H-canaliculatus_F_contig10252.264.1|organism=Hapterophycus canaliculatus Oshoro5f female|type=polypeptide|length=129bp MCGGGKHRSKHDKQIHQKQATGPTFYHARTLTKNKKKLFHNHRTTTEKCAback to top mRNA from alignment at H-canaliculatus_F_contig10252:4502..4913+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_H-canaliculatus_F_contig10252.264.1 ID=mRNA_H-canaliculatus_F_contig10252.264.1|Name=mRNA_H-canaliculatus_F_contig10252.264.1|organism=Hapterophycus canaliculatus Oshoro5f female|type=mRNA|length=412bp|location=Sequence derived from alignment at H-canaliculatus_F_contig10252:4502..4913+ (Hapterophycus canaliculatus Oshoro5f female)back to top Coding sequence (CDS) from alignment at H-canaliculatus_F_contig10252:4502..4913+ >mRNA_H-canaliculatus_F_contig10252.264.1 ID=mRNA_H-canaliculatus_F_contig10252.264.1|Name=mRNA_H-canaliculatus_F_contig10252.264.1|organism=Hapterophycus canaliculatus Oshoro5f female|type=CDS|length=774bp|location=Sequence derived from alignment at H-canaliculatus_F_contig10252:4502..4913+ (Hapterophycus canaliculatus Oshoro5f female)back to top |