mRNA_H-canaliculatus_F_contig10073.103.1 (mRNA) Hapterophycus canaliculatus Oshoro5f female
Overview
Homology
BLAST of mRNA_H-canaliculatus_F_contig10073.103.1 vs. uniprot
Match: D8LQV5_ECTSI (Acyltransferase n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LQV5_ECTSI) HSP 1 Score: 100 bits (250), Expect = 1.230e-23 Identity = 46/49 (93.88%), Postives = 46/49 (93.88%), Query Frame = 1 Query: 1 EAVPPPGECAILCPNHGNSLTDAISVVSQSPRMVRLTAKDNLWKDPIFG 147 EAVPP GEC ILCPNHGNSLTDAISVVSQ PRMVRLTAKDNLWKDPIFG Sbjct: 39 EAVPPQGECTILCPNHGNSLTDAISVVSQCPRMVRLTAKDNLWKDPIFG 87
BLAST of mRNA_H-canaliculatus_F_contig10073.103.1 vs. uniprot
Match: A0A4P9Y7P6_9FUNG (PlsC domain-containing protein n=1 Tax=Piptocephalis cylindrospora TaxID=1907219 RepID=A0A4P9Y7P6_9FUNG) HSP 1 Score: 62.4 bits (150), Expect = 4.560e-10 Identity = 29/52 (55.77%), Postives = 37/52 (71.15%), Query Frame = 1 Query: 1 EAVPPPGECAILCPNHGNSLTDAISVVSQSPR---MVRLTAKDNLWKDPIFG 147 E +PP G +ILCPNH NSLTD + +V+ +PR MVR+TAKD LW +FG Sbjct: 43 ENLPPDGVPSILCPNHSNSLTDGVLMVTSAPRQRAMVRMTAKDTLWDHWVFG 94
BLAST of mRNA_H-canaliculatus_F_contig10073.103.1 vs. uniprot
Match: A0A2R5GMB5_9STRA (Glycerol-3-phosphate O-acyltransferase 1 n=1 Tax=Hondaea fermentalgiana TaxID=2315210 RepID=A0A2R5GMB5_9STRA) HSP 1 Score: 61.2 bits (147), Expect = 1.160e-9 Identity = 25/49 (51.02%), Postives = 36/49 (73.47%), Query Frame = 1 Query: 1 EAVPPPGECAILCPNHGNSLTDAISVVSQSPRMVRLTAKDNLWKDPIFG 147 E +P GE +LC NHGNSLTD++ ++SQ+PR++R AK+ LW P+ G Sbjct: 34 ENLPAEGEPTLLCFNHGNSLTDSVVLISQTPRVIRFCAKNTLWDMPVVG 82
BLAST of mRNA_H-canaliculatus_F_contig10073.103.1 vs. uniprot
Match: U9UXF9_RHIID (PlsC domain-containing protein n=9 Tax=Glomeraceae TaxID=36751 RepID=U9UXF9_RHIID) HSP 1 Score: 52.8 bits (125), Expect = 1.140e-6 Identity = 28/54 (51.85%), Postives = 34/54 (62.96%), Query Frame = 1 Query: 1 EAVPPPGECAILCPNHGNSLTDAISVVSQSPR----MVRLTAKDNLWK-DPIFG 147 E +PP G ILCPNH NSLTD I ++S P M+R+TAKD WK + IF Sbjct: 29 ENIPPDGCPTILCPNHSNSLTDPILLLSVVPPEKRDMIRMTAKDTFWKKNDIFS 82
BLAST of mRNA_H-canaliculatus_F_contig10073.103.1 vs. uniprot
Match: A0A397IDT0_9GLOM (PlsC domain-containing protein n=1 Tax=Diversispora epigaea TaxID=1348612 RepID=A0A397IDT0_9GLOM) HSP 1 Score: 51.6 bits (122), Expect = 2.920e-6 Identity = 24/48 (50.00%), Postives = 31/48 (64.58%), Query Frame = 1 Query: 1 EAVPPPGECAILCPNHGNSLTDAISVVSQSPR----MVRLTAKDNLWK 132 E +PP G ILCPNH NSLTD + ++S P +VR+TAKD W+ Sbjct: 29 ENIPPDGCPTILCPNHSNSLTDPVCLLSSIPSKKRDLVRMTAKDTFWR 76
BLAST of mRNA_H-canaliculatus_F_contig10073.103.1 vs. uniprot
Match: K5W1Q6_AGABU (PlsC domain-containing protein n=3 Tax=Agaricus bisporus TaxID=5341 RepID=K5W1Q6_AGABU) HSP 1 Score: 48.5 bits (114), Expect = 3.580e-5 Identity = 24/50 (48.00%), Postives = 31/50 (62.00%), Query Frame = 1 Query: 7 VPPPGECAILCPNHGNSLTDAI----SVVSQSPRMVRLTAKDNLWKDPIF 144 +P G ++CPNHGNSLTDA+ S+ SQ M+RLTAK + P F Sbjct: 38 IPKTGRPCVVCPNHGNSLTDALILTTSIPSQRRNMLRLTAKATQFGHPTF 87 The following BLAST results are available for this feature:
BLAST of mRNA_H-canaliculatus_F_contig10073.103.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Hapterophycus canaliculatus Oshoro5f female vs UniRef90) Total hits: 6
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_H-canaliculatus_F_contig10073.103.1 >prot_H-canaliculatus_F_contig10073.103.1 ID=prot_H-canaliculatus_F_contig10073.103.1|Name=mRNA_H-canaliculatus_F_contig10073.103.1|organism=Hapterophycus canaliculatus Oshoro5f female|type=polypeptide|length=50bp EAVPPPGECAILCPNHGNSLTDAISVVSQSPRMVRLTAKDNLWKDPIFG*back to top mRNA from alignment at H-canaliculatus_F_contig10073:86..235- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_H-canaliculatus_F_contig10073.103.1 ID=mRNA_H-canaliculatus_F_contig10073.103.1|Name=mRNA_H-canaliculatus_F_contig10073.103.1|organism=Hapterophycus canaliculatus Oshoro5f female|type=mRNA|length=150bp|location=Sequence derived from alignment at H-canaliculatus_F_contig10073:86..235- (Hapterophycus canaliculatus Oshoro5f female)back to top Coding sequence (CDS) from alignment at H-canaliculatus_F_contig10073:86..235- >mRNA_H-canaliculatus_F_contig10073.103.1 ID=mRNA_H-canaliculatus_F_contig10073.103.1|Name=mRNA_H-canaliculatus_F_contig10073.103.1|organism=Hapterophycus canaliculatus Oshoro5f female|type=CDS|length=300bp|location=Sequence derived from alignment at H-canaliculatus_F_contig10073:86..235- (Hapterophycus canaliculatus Oshoro5f female)back to top |