mRNA_H-canaliculatus_F_contig10.14.1 (mRNA) Hapterophycus canaliculatus Oshoro5f female
You are viewing an mRNA, more information available on the corresponding polypeptide page
Overview
Homology
BLAST of mRNA_H-canaliculatus_F_contig10.14.1 vs. uniprot
Match: A0A6H5K718_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5K718_9PHAE) HSP 1 Score: 72.8 bits (177), Expect = 1.260e-12 Identity = 32/53 (60.38%), Postives = 42/53 (79.25%), Query Frame = 2 Query: 209 HRRKANAVLLEQAGGNPKEAGLHSLRIGAASTLVVGGGIPKRVIQREGRWKGG 367 + + +A ++E+AGGNPK+ GLHSLRIGAA+TL GG +P R+IQ EGRWK G Sbjct: 211 YSKALSAQIVEKAGGNPKQVGLHSLRIGAATTLAAGGDVPDRIIQGEGRWKEG 263
BLAST of mRNA_H-canaliculatus_F_contig10.14.1 vs. uniprot
Match: A0A6H5JL16_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JL16_9PHAE) HSP 1 Score: 67.8 bits (164), Expect = 3.970e-12 Identity = 29/45 (64.44%), Postives = 36/45 (80.00%), Query Frame = 2 Query: 233 LLEQAGGNPKEAGLHSLRIGAASTLVVGGGIPKRVIQREGRWKGG 367 ++E+AGG+PK+ GLHSLRIGA +TL GG +P R QREGRWK G Sbjct: 39 IVEEAGGDPKQVGLHSLRIGATTTLAAGGDVPDRTTQREGRWKEG 83
BLAST of mRNA_H-canaliculatus_F_contig10.14.1 vs. uniprot
Match: A0A6H5KTP7_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KTP7_9PHAE) HSP 1 Score: 67.0 bits (162), Expect = 2.800e-10 Identity = 28/43 (65.12%), Postives = 37/43 (86.05%), Query Frame = 2 Query: 233 LLEQAGGNPKEAGLHSLRIGAASTLVVGGGIPKRVIQREGRWK 361 ++++AGG+PK+ GLHSLRIGAA+TL GG +P R+IQ EGRWK Sbjct: 838 IVDKAGGDPKQVGLHSLRIGAATTLAAGGDVPDRIIQSEGRWK 880 The following BLAST results are available for this feature:
BLAST of mRNA_H-canaliculatus_F_contig10.14.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Hapterophycus canaliculatus Oshoro5f female vs UniRef90) Total hits: 3 ZOOMx 1POSITION0
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_H-canaliculatus_F_contig10.14.1 >prot_H-canaliculatus_F_contig10.14.1 ID=prot_H-canaliculatus_F_contig10.14.1|Name=mRNA_H-canaliculatus_F_contig10.14.1|organism=Hapterophycus canaliculatus Oshoro5f female|type=polypeptide|length=125bp MGSPSLFGSHVHNVLNVTGMQGRRQQSAVVRPCASSALCHLISGPVYTFAback to top mRNA from alignment at H-canaliculatus_F_contig10:18817..19222+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_H-canaliculatus_F_contig10.14.1 ID=mRNA_H-canaliculatus_F_contig10.14.1|Name=mRNA_H-canaliculatus_F_contig10.14.1|organism=Hapterophycus canaliculatus Oshoro5f female|type=mRNA|length=406bp|location=Sequence derived from alignment at H-canaliculatus_F_contig10:18817..19222+ (Hapterophycus canaliculatus Oshoro5f female)back to top Coding sequence (CDS) from alignment at H-canaliculatus_F_contig10:18817..19222+ >mRNA_H-canaliculatus_F_contig10.14.1 ID=mRNA_H-canaliculatus_F_contig10.14.1|Name=mRNA_H-canaliculatus_F_contig10.14.1|organism=Hapterophycus canaliculatus Oshoro5f female|type=CDS|length=750bp|location=Sequence derived from alignment at H-canaliculatus_F_contig10:18817..19222+ (Hapterophycus canaliculatus Oshoro5f female)back to top |