mRNA_H-paniculata_contig10526.342.1 (mRNA) Halopteris paniculata Hal_grac_a_UBK monoicous
Overview
Homology
BLAST of mRNA_H-paniculata_contig10526.342.1 vs. uniprot
Match: A0A6H5KT36_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KT36_9PHAE) HSP 1 Score: 55.8 bits (133), Expect = 3.410e-7 Identity = 22/35 (62.86%), Postives = 29/35 (82.86%), Query Frame = 1 Query: 31 DNCTKHPHYAFEGDKARFCATHKEPGMVDVKHKRC 135 ++C KH YAF G+KA+FC++HK PGMVDV +KRC Sbjct: 14 EHCLKHRMYAFPGEKAQFCSSHKMPGMVDVHNKRC 48
BLAST of mRNA_H-paniculata_contig10526.342.1 vs. uniprot
Match: D7G0X0_ECTSI (EsV-1-7 n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G0X0_ECTSI) HSP 1 Score: 52.4 bits (124), Expect = 5.690e-6 Identity = 20/37 (54.05%), Postives = 28/37 (75.68%), Query Frame = 1 Query: 22 CEFDNCTKHPHYAFEGDKARFCATHKEPGMVDVKHKR 132 CEF CT+ P Y +G +AR+C++HKE GM+DVK+ R Sbjct: 10 CEFFECTRQPTYGQDGQRARYCSSHKEEGMIDVKNCR 46
BLAST of mRNA_H-paniculata_contig10526.342.1 vs. uniprot
Match: A0A7S3Y6U3_HETAK (Hypothetical protein (Fragment) n=1 Tax=Heterosigma akashiwo TaxID=2829 RepID=A0A7S3Y6U3_HETAK) HSP 1 Score: 47.8 bits (112), Expect = 7.610e-5 Identity = 20/35 (57.14%), Postives = 25/35 (71.43%), Query Frame = 1 Query: 22 CEFDNCTKHPHYAFEGD-KARFCATHKEPGMVDVK 123 CE C K P + FEG+ +ARFCA H+ PGMVD+K Sbjct: 6 CEEGGCNKQPSFTFEGEHRARFCAQHQRPGMVDLK 40
BLAST of mRNA_H-paniculata_contig10526.342.1 vs. uniprot
Match: A0A6H5JKV8_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JKV8_9PHAE) HSP 1 Score: 48.9 bits (115), Expect = 9.460e-5 Identity = 20/38 (52.63%), Postives = 26/38 (68.42%), Query Frame = 1 Query: 19 PCEFDNCTKHPHYAFEGDKARFCATHKEPGMVDVKHKR 132 PCE + CT P + G K RFCA+HKE GMV++K +R Sbjct: 296 PCEKEGCTVSPRFGDVGGKPRFCASHKESGMVNLKDRR 333 The following BLAST results are available for this feature:
BLAST of mRNA_H-paniculata_contig10526.342.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 4
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_H-paniculata_contig10526.342.1 >prot_H-paniculata_contig10526.342.1 ID=prot_H-paniculata_contig10526.342.1|Name=mRNA_H-paniculata_contig10526.342.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=polypeptide|length=81bp VDVHCRPCEFDNCTKHPHYAFEGDKARFCATHKEPGMVDVKHKRCHTTGCback to top mRNA from alignment at H-paniculata_contig10526:7530..8471- Legend: polypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_H-paniculata_contig10526.342.1 ID=mRNA_H-paniculata_contig10526.342.1|Name=mRNA_H-paniculata_contig10526.342.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=mRNA|length=942bp|location=Sequence derived from alignment at H-paniculata_contig10526:7530..8471- (Halopteris paniculata Hal_grac_a_UBK monoicous)back to top Coding sequence (CDS) from alignment at H-paniculata_contig10526:7530..8471- >mRNA_H-paniculata_contig10526.342.1 ID=mRNA_H-paniculata_contig10526.342.1|Name=mRNA_H-paniculata_contig10526.342.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=CDS|length=486bp|location=Sequence derived from alignment at H-paniculata_contig10526:7530..8471- (Halopteris paniculata Hal_grac_a_UBK monoicous)back to top |