prot_H-paniculata_contig14661.2786.1 (polypeptide) Halopteris paniculata Hal_grac_a_UBK monoicous
Overview
Homology
BLAST of mRNA_H-paniculata_contig14661.2786.1 vs. uniprot
Match: A0A6H5K639_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5K639_9PHAE) HSP 1 Score: 56.2 bits (134), Expect = 1.610e-6 Identity = 25/36 (69.44%), Postives = 28/36 (77.78%), Query Frame = 0 Query: 101 RQRTSKYPGVSFFKGRYTAQLTWGGKQVRYAKINTK 136 R RTSKY GVSFFKGRYTAQ TWGGKQ + +T+ Sbjct: 246 RVRTSKYHGVSFFKGRYTAQFTWGGKQYYLGRYDTE 281
BLAST of mRNA_H-paniculata_contig14661.2786.1 vs. uniprot
Match: D7G2A6_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G2A6_ECTSI) HSP 1 Score: 54.7 bits (130), Expect = 3.760e-6 Identity = 24/36 (66.67%), Postives = 28/36 (77.78%), Query Frame = 0 Query: 101 RQRTSKYPGVSFFKGRYTAQLTWGGKQVRYAKINTK 136 R RTSKY GVSFFKGR+TAQ TWGGKQ + +T+ Sbjct: 180 RVRTSKYHGVSFFKGRFTAQFTWGGKQYYLGRYDTE 215 The following BLAST results are available for this feature:
BLAST of mRNA_H-paniculata_contig14661.2786.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_H-paniculata_contig14661.2786.1 ID=prot_H-paniculata_contig14661.2786.1|Name=mRNA_H-paniculata_contig14661.2786.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=polypeptide|length=136bpback to top |