prot_H-paniculata_contig14440.2669.1 (polypeptide) Halopteris paniculata Hal_grac_a_UBK monoicous
Overview
Homology
BLAST of mRNA_H-paniculata_contig14440.2669.1 vs. uniprot
Match: A0A6H5JFD9_9PHAE (Uncharacterized protein n=2 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JFD9_9PHAE) HSP 1 Score: 65.1 bits (157), Expect = 8.550e-11 Identity = 34/49 (69.39%), Postives = 40/49 (81.63%), Query Frame = 0 Query: 1 MPVETTLETTRVQDARISTARKQKERFTLHLAMMSDGRNVTPRIAVKGT 49 MPVETTLE T +DARIST K+KERFTL LA+M+DG+ V+PRI KGT Sbjct: 296 MPVETTLEKTGAKDARISTGGKEKERFTLVLAVMADGKKVSPRIIFKGT 344
BLAST of mRNA_H-paniculata_contig14440.2669.1 vs. uniprot
Match: A0A6H5JUK2_9PHAE (DDE-1 domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JUK2_9PHAE) HSP 1 Score: 65.1 bits (157), Expect = 9.100e-11 Identity = 34/49 (69.39%), Postives = 40/49 (81.63%), Query Frame = 0 Query: 1 MPVETTLETTRVQDARISTARKQKERFTLHLAMMSDGRNVTPRIAVKGT 49 MPVETTLE T +DARIST K+KERFTL LA+M+DG+ V+PRI KGT Sbjct: 129 MPVETTLEKTGAKDARISTGGKEKERFTLVLAVMADGKKVSPRIIFKGT 177
BLAST of mRNA_H-paniculata_contig14440.2669.1 vs. uniprot
Match: A0A6H5K6L9_9PHAE (DDE-1 domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5K6L9_9PHAE) HSP 1 Score: 63.5 bits (153), Expect = 3.230e-10 Identity = 33/49 (67.35%), Postives = 40/49 (81.63%), Query Frame = 0 Query: 1 MPVETTLETTRVQDARISTARKQKERFTLHLAMMSDGRNVTPRIAVKGT 49 +PVETTLE T +DARIST K+KERFTL LA+M+DG+ V+PRI KGT Sbjct: 129 IPVETTLEKTGAKDARISTGGKEKERFTLVLAVMADGKKVSPRIIFKGT 177
BLAST of mRNA_H-paniculata_contig14440.2669.1 vs. uniprot
Match: A0A6H5KRZ8_9PHAE (DDE-1 domain-containing protein n=3 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KRZ8_9PHAE) HSP 1 Score: 63.5 bits (153), Expect = 3.260e-10 Identity = 33/49 (67.35%), Postives = 40/49 (81.63%), Query Frame = 0 Query: 1 MPVETTLETTRVQDARISTARKQKERFTLHLAMMSDGRNVTPRIAVKGT 49 MPVETTLE T +DARIST ++KERFTL LA+M+DG+ V+PRI KGT Sbjct: 311 MPVETTLEKTGAKDARISTGGEEKERFTLVLAVMADGKKVSPRIIFKGT 359
BLAST of mRNA_H-paniculata_contig14440.2669.1 vs. uniprot
Match: A0A6H5KT06_9PHAE (DDE-1 domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KT06_9PHAE) HSP 1 Score: 62.0 bits (149), Expect = 7.950e-10 Identity = 32/49 (65.31%), Postives = 39/49 (79.59%), Query Frame = 0 Query: 1 MPVETTLETTRVQDARISTARKQKERFTLHLAMMSDGRNVTPRIAVKGT 49 MPVETTLE T +DARIST K++ERF L LA+M+DG+ V+PRI KGT Sbjct: 10 MPVETTLEKTGAKDARISTGGKEQERFALVLAVMADGKKVSPRITFKGT 58
BLAST of mRNA_H-paniculata_contig14440.2669.1 vs. uniprot
Match: A0A6H5JTG5_9PHAE (DDE-1 domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JTG5_9PHAE) HSP 1 Score: 60.1 bits (144), Expect = 5.430e-9 Identity = 33/49 (67.35%), Postives = 39/49 (79.59%), Query Frame = 0 Query: 1 MPVETTLETTRVQDARISTARKQKERFTLHLAMMSDGRNVTPRIAVKGT 49 MPVETTLE T +DARIST K+KERFTL LA+M+DG+ V+P I KGT Sbjct: 283 MPVETTLEDTGGKDARISTGGKEKERFTLVLAVMADGKMVSPCIIFKGT 331
BLAST of mRNA_H-paniculata_contig14440.2669.1 vs. uniprot
Match: A0A6H5L819_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5L819_9PHAE) HSP 1 Score: 57.8 bits (138), Expect = 3.470e-8 Identity = 31/52 (59.62%), Postives = 38/52 (73.08%), Query Frame = 0 Query: 1 MPVETTLETTRVQDARISTARKQKERFTLHLAMMSDGRNVTPRIAVKGTLLF 52 +PV TLE T +DARIST K+KERFTL LA+M+DG+ V+PR KGT F Sbjct: 280 VPVAITLEKTGAKDARISTGGKEKERFTLVLAVMADGKKVSPRNIFKGTPFF 331
BLAST of mRNA_H-paniculata_contig14440.2669.1 vs. uniprot
Match: A0A6H5JUV9_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JUV9_9PHAE) HSP 1 Score: 54.7 bits (130), Expect = 3.790e-8 Identity = 28/43 (65.12%), Postives = 34/43 (79.07%), Query Frame = 0 Query: 7 LETTRVQDARISTARKQKERFTLHLAMMSDGRNVTPRIAVKGT 49 LE T +DARIST K+KERFTL LA+M+DG+ V+PRI KGT Sbjct: 8 LEKTGAKDARISTGSKEKERFTLVLAVMADGKKVSPRIIFKGT 50
BLAST of mRNA_H-paniculata_contig14440.2669.1 vs. uniprot
Match: A0A6H5K8Y4_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5K8Y4_9PHAE) HSP 1 Score: 57.4 bits (137), Expect = 4.910e-8 Identity = 31/49 (63.27%), Postives = 37/49 (75.51%), Query Frame = 0 Query: 1 MPVETTLETTRVQDARISTARKQKERFTLHLAMMSDGRNVTPRIAVKGT 49 MPVETTLE T +DARI+T K+KERFTL LA+ +DG+ V RI KGT Sbjct: 283 MPVETTLENTGAKDARIATGGKEKERFTLCLAVSADGKKVPLRIIFKGT 331
BLAST of mRNA_H-paniculata_contig14440.2669.1 vs. uniprot
Match: A0A6H5JQM5_9PHAE (DDE-1 domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JQM5_9PHAE) HSP 1 Score: 54.7 bits (130), Expect = 4.330e-7 Identity = 34/60 (56.67%), Postives = 40/60 (66.67%), Query Frame = 0 Query: 1 MPVETTLETTRVQDARISTARKQKERFTLHLAMMSDGRNVTPRIAVKGTLLFLGDESCRR 60 MPVETTLE +DARIST K+KERFTL LA+M+DG V RI KG F+ + RR Sbjct: 302 MPVETTLEKGGAKDARISTGGKEKERFTLCLAVMADGGKVPLRIIFKGKP-FIPPSTARR 360 The following BLAST results are available for this feature:
BLAST of mRNA_H-paniculata_contig14440.2669.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 14
Pagesback to topAlignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_H-paniculata_contig14440.2669.1 ID=prot_H-paniculata_contig14440.2669.1|Name=mRNA_H-paniculata_contig14440.2669.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=polypeptide|length=64bpback to top |