mRNA_H-paniculata_contig12798.1754.1 (mRNA) Halopteris paniculata Hal_grac_a_UBK monoicous
Overview
Homology
BLAST of mRNA_H-paniculata_contig12798.1754.1 vs. uniprot
Match: A0A6H5L244_9PHAE (Uncharacterized protein n=2 Tax=Ectocarpus TaxID=2879 RepID=A0A6H5L244_9PHAE) HSP 1 Score: 78.2 bits (191), Expect = 1.090e-15 Identity = 34/52 (65.38%), Postives = 41/52 (78.85%), Query Frame = 1 Query: 1 KLVRVPKAASTAVSMVARRLAGCTPPGPCCRYPGDPPGSCAVAGLMCDKVCG 156 +L+RVPKA S+ S++ARRL GC P GPCCR+PGDPPGSC + GLMC V G Sbjct: 59 QLIRVPKAGSSEASVIARRLGGCVPRGPCCRFPGDPPGSCPLEGLMCPMVTG 110
BLAST of mRNA_H-paniculata_contig12798.1754.1 vs. uniprot
Match: D7G3X3_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G3X3_ECTSI) HSP 1 Score: 72.8 bits (177), Expect = 2.350e-15 Identity = 32/49 (65.31%), Postives = 37/49 (75.51%), Query Frame = 1 Query: 10 RVPKAASTAVSMVARRLAGCTPPGPCCRYPGDPPGSCAVAGLMCDKVCG 156 RVPKA S+ S++ARRL GC P GPCC +PGDPPGSC + GLMC V G Sbjct: 4 RVPKAGSSEASVIARRLGGCVPRGPCCAFPGDPPGSCPLEGLMCPMVTG 52
BLAST of mRNA_H-paniculata_contig12798.1754.1 vs. uniprot
Match: D7FWY0_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FWY0_ECTSI) HSP 1 Score: 70.9 bits (172), Expect = 4.780e-13 Identity = 33/52 (63.46%), Postives = 37/52 (71.15%), Query Frame = 1 Query: 1 KLVRVPKAASTAVSMVARRLAGCTPPGPCCRYPGDPPGSCAVAGLMCDKVCG 156 +LVRVPKA S+ S++ARRL GC P GPCC PG PPGSC GLMC V G Sbjct: 78 QLVRVPKAGSSEASVIARRLGGCVPRGPCCMMPGHPPGSCPSEGLMCPAVLG 129
BLAST of mRNA_H-paniculata_contig12798.1754.1 vs. uniprot
Match: A0A6H5KAL5_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KAL5_9PHAE) HSP 1 Score: 67.0 bits (162), Expect = 1.150e-11 Identity = 32/51 (62.75%), Postives = 35/51 (68.63%), Query Frame = 1 Query: 4 LVRVPKAASTAVSMVARRLAGCTPPGPCCRYPGDPPGSCAVAGLMCDKVCG 156 L+ VPKA S+ S+VARRL GC P GPCC PG PPGSC GLMC V G Sbjct: 53 LMLVPKAGSSEASVVARRLGGCVPRGPCCMMPGHPPGSCPSEGLMCPAVLG 103
BLAST of mRNA_H-paniculata_contig12798.1754.1 vs. uniprot
Match: A0A482SEE5_9ARCH (Uncharacterized protein n=1 Tax=archaeon TaxID=1906665 RepID=A0A482SEE5_9ARCH) HSP 1 Score: 50.4 bits (119), Expect = 7.190e-6 Identity = 19/27 (70.37%), Postives = 21/27 (77.78%), Query Frame = 1 Query: 58 LAGCTPPGPCCRYPGDPPGSCAVAGLM 138 + GC PPGPCCR+PGDPPGSC GL Sbjct: 1 MVGCYPPGPCCRWPGDPPGSCPAKGLF 27 The following BLAST results are available for this feature:
BLAST of mRNA_H-paniculata_contig12798.1754.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 5
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_H-paniculata_contig12798.1754.1 >prot_H-paniculata_contig12798.1754.1 ID=prot_H-paniculata_contig12798.1754.1|Name=mRNA_H-paniculata_contig12798.1754.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=polypeptide|length=52bp KLVRVPKAASTAVSMVARRLAGCTPPGPCCRYPGDPPGSCAVAGLMCDKVback to top mRNA from alignment at H-paniculata_contig12798:161..316+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_H-paniculata_contig12798.1754.1 ID=mRNA_H-paniculata_contig12798.1754.1|Name=mRNA_H-paniculata_contig12798.1754.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=mRNA|length=156bp|location=Sequence derived from alignment at H-paniculata_contig12798:161..316+ (Halopteris paniculata Hal_grac_a_UBK monoicous)back to top Coding sequence (CDS) from alignment at H-paniculata_contig12798:161..316+ >mRNA_H-paniculata_contig12798.1754.1 ID=mRNA_H-paniculata_contig12798.1754.1|Name=mRNA_H-paniculata_contig12798.1754.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=CDS|length=312bp|location=Sequence derived from alignment at H-paniculata_contig12798:161..316+ (Halopteris paniculata Hal_grac_a_UBK monoicous)back to top |