mRNA_H-paniculata_contig12255.1436.1 (mRNA) Halopteris paniculata Hal_grac_a_UBK monoicous
Overview
Homology
BLAST of mRNA_H-paniculata_contig12255.1436.1 vs. uniprot
Match: D8LM43_ECTSI (Ankyrin repeat Transient receptor potential channel n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LM43_ECTSI) HSP 1 Score: 108 bits (270), Expect = 2.100e-23 Identity = 53/82 (64.63%), Postives = 68/82 (82.93%), Query Frame = -2 Query: 61 MQQIHSSLGPLVHSTFEMMTDLVRFGALMLVITMGFALCFYALFGSVSASLSEDAQLEEYSSYYTSMLTLFESMLGSFRFDV 306 + Q+HSSLGPL+HS F ++ DL RFGALMLVIT+GFAL FYA+FGS+SASL + + EY +YY+S+LTLF SMLG+F F+V Sbjct: 787 LTQVHSSLGPLMHSAFNVIGDLTRFGALMLVITLGFALAFYAMFGSMSASLPDGGDIAEYDTYYSSILTLFSSMLGNFSFEV 868
BLAST of mRNA_H-paniculata_contig12255.1436.1 vs. uniprot
Match: A0A6H5KCQ6_9PHAE (Ion_trans domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KCQ6_9PHAE) HSP 1 Score: 105 bits (263), Expect = 1.660e-22 Identity = 54/88 (61.36%), Postives = 69/88 (78.41%), Query Frame = -2 Query: 61 FITGPRMQQIHSSLGPLVHSTFEMMTDLVRFGALMLVITMGFALCFYALFGSVSASLSEDAQLEEYSSYYTSMLTLFESMLGSFRFDV 324 F+T R +HSSLGPL+HS F ++ DL RFGALMLVIT+GFAL FYA+FGS+SASL + + EY +YY+S+LTLF SM G+F F+V Sbjct: 462 FLTQAR---VHSSLGPLMHSAFNVIGDLTRFGALMLVITLGFALAFYAMFGSMSASLPDGGDIAEYDTYYSSILTLFSSMFGNFSFEV 546 The following BLAST results are available for this feature:
BLAST of mRNA_H-paniculata_contig12255.1436.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_H-paniculata_contig12255.1436.1 >prot_H-paniculata_contig12255.1436.1 ID=prot_H-paniculata_contig12255.1436.1|Name=mRNA_H-paniculata_contig12255.1436.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=polypeptide|length=127bp MKHCSAVCDSGSRGRRQVCRAGAGTGGAPILREGQPWREIRSWWKFTRSVback to top mRNA from alignment at H-paniculata_contig12255:1276..1975+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_H-paniculata_contig12255.1436.1 ID=mRNA_H-paniculata_contig12255.1436.1|Name=mRNA_H-paniculata_contig12255.1436.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=mRNA|length=700bp|location=Sequence derived from alignment at H-paniculata_contig12255:1276..1975+ (Halopteris paniculata Hal_grac_a_UBK monoicous)back to top Coding sequence (CDS) from alignment at H-paniculata_contig12255:1276..1975+ >mRNA_H-paniculata_contig12255.1436.1 ID=mRNA_H-paniculata_contig12255.1436.1|Name=mRNA_H-paniculata_contig12255.1436.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=CDS|length=762bp|location=Sequence derived from alignment at H-paniculata_contig12255:1276..1975+ (Halopteris paniculata Hal_grac_a_UBK monoicous)back to top |