prot_H-paniculata_contig5902.13528.1 (polypeptide) Halopteris paniculata Hal_grac_a_UBK monoicous

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview


Name	mRNA_H-paniculata_contig5902.13528.1
Unique Name	prot_H-paniculata_contig5902.13528.1
Type	polypeptide
Organism	Halopteris paniculata Hal_grac_a_UBK monoicous (Halopteris paniculata Hal_grac_a_UBK monoicous)
Sequence length	262

Homology

The following BLAST results are available for this feature:

BLAST of mRNA_H-paniculata_contig5902.13528.1 vs. uniprot

BLAST of mRNA_H-paniculata_contig5902.13528.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90)
Total hits: 0


Match Name	E-value	Identity	Description

InterPro

Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29


IPR Term	IPR Description	Source	Source Term	Source Description	Alignment
None	No IPR available	PHOBIUS	TRANSMEMBRANE	Transmembrane region	coord: 207..227
None	No IPR available	PHOBIUS	CYTOPLASMIC_DOMAIN	Cytoplasmic domain	coord: 188..206
None	No IPR available	PHOBIUS	NON_CYTOPLASMIC_DOMAIN	Non cytoplasmic domain	coord: 26..67
None	No IPR available	PHOBIUS	TRANSMEMBRANE	Transmembrane region	coord: 114..138
None	No IPR available	PHOBIUS	NON_CYTOPLASMIC_DOMAIN	Non cytoplasmic domain	coord: 139..157
None	No IPR available	PHOBIUS	NON_CYTOPLASMIC_DOMAIN	Non cytoplasmic domain	coord: 228..261
None	No IPR available	PHOBIUS	TRANSMEMBRANE	Transmembrane region	coord: 158..187
None	No IPR available	PHOBIUS	TRANSMEMBRANE	Transmembrane region	coord: 68..93
None	No IPR available	PHOBIUS	CYTOPLASMIC_DOMAIN	Cytoplasmic domain	coord: 1..6
None	No IPR available	PHOBIUS	CYTOPLASMIC_DOMAIN	Cytoplasmic domain	coord: 94..113
None	No IPR available	PHOBIUS	TRANSMEMBRANE	Transmembrane region	coord: 7..25
None	No IPR available	TMHMM	TMhelix		coord: 207..229
None	No IPR available	TMHMM	TMhelix		coord: 114..136
None	No IPR available	TMHMM	TMhelix		coord: 7..29
None	No IPR available	TMHMM	TMhelix		coord: 72..94
None	No IPR available	TMHMM	TMhelix		coord: 156..178

Alignments

The following features are aligned


Aligned Feature	Feature Type	Alignment Location
H-paniculata_contig5902	contig	H-paniculata_contig5902:8055..8840 +

Analyses

This polypeptide is derived from or has results from the following analyses


Analysis Name	Date Performed
InterProScan on OGS1.0	2022-09-29
Diamond blastp: OGS1.0 vs UniRef90	2022-09-16
OGS1.0 of Halopteris paniculata Hal_grac_a_UBK monoicous	2021-02-24

Relationships

This polypeptide derives from the following mRNA feature(s):


Feature Name	Unique Name	Species	Type	Position
mRNA_H-paniculata_contig5902.13528.1	mRNA_H-paniculata_contig5902.13528.1	Halopteris paniculata Hal_grac_a_UBK monoicous	mRNA	H-paniculata_contig5902 1787..10949 +

Sequences

The following sequences are available for this feature:

polypeptide sequence

polypeptide sequence

>prot_H-paniculata_contig5902.13528.1 ID=prot_H-paniculata_contig5902.13528.1|Name=mRNA_H-paniculata_contig5902.13528.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=polypeptide|length=262bp
MKSWTCFIVGNSLVVAVLLIEIITLDVCFDGFDSFDGYSDDRFQNRAELD
DEEAIDIDQAELLVSNMVMVALIAGLSLEVISAVILSSTYGVPLDAMSAY
KIPAHDRRYCLAGFIARFVAPITWGLICVCMGAASYLYNSYTPCGGGPDM
SERTRYAFLVVFGLMMAIFGGVLVLVSLLMGCFACGFEPCCFSCCCRSGR
SCMHRRVLAVAWLFDLWWQLAGVMWAYRTGNFGLNNTILLLAVNVLGDMM
SEFGSCPPPDV*