prot_H-paniculata_contig12045.1302.1 (polypeptide) Halopteris paniculata Hal_grac_a_UBK monoicous
Overview
Homology
BLAST of mRNA_H-paniculata_contig12045.1302.1 vs. uniprot
Match: D8LNM6_ECTSI (DDE_3 domain-containing protein n=3 Tax=Ectocarpus TaxID=2879 RepID=D8LNM6_ECTSI) HSP 1 Score: 94.0 bits (232), Expect = 6.170e-20 Identity = 48/69 (69.57%), Postives = 53/69 (76.81%), Query Frame = 0 Query: 1 MLLFALRKGGVSENQSVLQVASTFKISHSKVRDINNHWWDNNTLLETTGEGRGKVTKNDDGRRRRTQDQ 69 MLLF LRK G SEN++VLQVA TFKI H KVR INNHWWD+ L ETT GRGK+ K DDGRRR T+ Q Sbjct: 143 MLLFDLRKEGRSENEAVLQVARTFKIGHDKVRRINNHWWDHRQLYETTAAGRGKMAKEDDGRRRLTEVQ 211 The following BLAST results are available for this feature:
BLAST of mRNA_H-paniculata_contig12045.1302.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_H-paniculata_contig12045.1302.1 ID=prot_H-paniculata_contig12045.1302.1|Name=mRNA_H-paniculata_contig12045.1302.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=polypeptide|length=121bpback to top |