mRNA_H-paniculata_contig11500.969.1 (mRNA) Halopteris paniculata Hal_grac_a_UBK monoicous
Overview
Homology
BLAST of mRNA_H-paniculata_contig11500.969.1 vs. uniprot
Match: D8LJ31_ECTSI (MFS domain-containing protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LJ31_ECTSI) HSP 1 Score: 113 bits (283), Expect = 1.900e-31 Identity = 47/75 (62.67%), Postives = 65/75 (86.67%), Query Frame = 1 Query: 1 LPSVFDGHGMDLRWQGWVSSLYGIMSFFIAPVLARASDSLGRVSMLQVSAIGSLAGALGSLYATEKWSFIAARLV 225 +P+ F+ HGMDLRWQGWV+S YG++SFF+ P+L R SDS+GRV+ML++S +G++ GALGSLYAT +W+FIA+R V Sbjct: 1 MPAAFESHGMDLRWQGWVASTYGLISFFVGPMLGRVSDSMGRVAMLKMSCVGNIIGALGSLYATGRWTFIASRKV 75
BLAST of mRNA_H-paniculata_contig11500.969.1 vs. uniprot
Match: A0A6H5JC31_9PHAE (MFS domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JC31_9PHAE) HSP 1 Score: 113 bits (283), Expect = 1.280e-27 Identity = 47/73 (64.38%), Postives = 64/73 (87.67%), Query Frame = 1 Query: 1 LPSVFDGHGMDLRWQGWVSSLYGIMSFFIAPVLARASDSLGRVSMLQVSAIGSLAGALGSLYATEKWSFIAAR 219 +P+ F+ HGMDLRWQGWV+S YGI+SFF+ P+L R SDS+GRV+ML++S +G++ GALGSLYAT +W+FIA+R Sbjct: 85 MPAAFESHGMDLRWQGWVASTYGIISFFVGPMLGRVSDSMGRVAMLKMSCVGNMIGALGSLYATGRWTFIASR 157
BLAST of mRNA_H-paniculata_contig11500.969.1 vs. uniprot
Match: A0A835Z3Q7_9STRA (Major facilitator superfamily domain-containing protein n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A835Z3Q7_9STRA) HSP 1 Score: 77.8 bits (190), Expect = 4.730e-15 Identity = 39/78 (50.00%), Postives = 56/78 (71.79%), Query Frame = 1 Query: 1 LPS---VFDGHGMDLRWQGWVSSLYGIMSFFIAPVLARASDSLGRVSMLQVSAIGSLAGALGSLYATEKWSFIAARLV 225 LPS +F +GMDL QG+V S + +F ++P+L RASDS GRV++L++SA GS+ GA G+L A KW+FI AR++ Sbjct: 54 LPSFRDLFASYGMDLVQQGYVGSASALSAFVMSPILGRASDSYGRVTLLKLSAAGSILGAAGTLLAPNKWAFILARVL 131 The following BLAST results are available for this feature:
BLAST of mRNA_H-paniculata_contig11500.969.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 3
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following polypeptide feature(s) derives from this mRNA:
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_H-paniculata_contig11500.969.1 >prot_H-paniculata_contig11500.969.1 ID=prot_H-paniculata_contig11500.969.1|Name=mRNA_H-paniculata_contig11500.969.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=polypeptide|length=66bp MDLRWQGWVSSLYGIMSFFIAPVLARASDSLGRVSMLQVSAIGSLAGALGback to top mRNA from alignment at H-paniculata_contig11500:3567..4248+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_H-paniculata_contig11500.969.1 ID=mRNA_H-paniculata_contig11500.969.1|Name=mRNA_H-paniculata_contig11500.969.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=mRNA|length=682bp|location=Sequence derived from alignment at H-paniculata_contig11500:3567..4248+ (Halopteris paniculata Hal_grac_a_UBK monoicous)back to top Coding sequence (CDS) from alignment at H-paniculata_contig11500:3567..4248+ >mRNA_H-paniculata_contig11500.969.1 ID=mRNA_H-paniculata_contig11500.969.1|Name=mRNA_H-paniculata_contig11500.969.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=CDS|length=396bp|location=Sequence derived from alignment at H-paniculata_contig11500:3567..4248+ (Halopteris paniculata Hal_grac_a_UBK monoicous)back to top |