prot_H-paniculata_contig9996.17571.1 (polypeptide) Halopteris paniculata Hal_grac_a_UBK monoicous
Overview
Homology
BLAST of mRNA_H-paniculata_contig9996.17571.1 vs. uniprot
Match: D7G139_ECTSI (Uncharacterized protein n=2 Tax=Ectocarpus TaxID=2879 RepID=D7G139_ECTSI) HSP 1 Score: 60.1 bits (144), Expect = 3.640e-8 Identity = 41/57 (71.93%), Postives = 43/57 (75.44%), Query Frame = 0 Query: 1 MDRDGVTFGDFG--TGGXXXXXXXXXXXXXXXGGKPVVDQDLMDTWYPDCRECTCCK 55 MD DGVTFGDFG XXXXXXXXXXXX G + QDLMDTWYPDCREC+CCK Sbjct: 323 MDSDGVTFGDFGGXXXXXXXXXXXXXXXXRGAGARSTAQQDLMDTWYPDCRECSCCK 379
BLAST of mRNA_H-paniculata_contig9996.17571.1 vs. uniprot
Match: A0A7S4MJ14_9EUKA (Hypothetical protein (Fragment) n=1 Tax=Vannella sp. CB-2014 TaxID=1487602 RepID=A0A7S4MJ14_9EUKA) HSP 1 Score: 52.4 bits (124), Expect = 1.660e-5 Identity = 20/43 (46.51%), Postives = 27/43 (62.79%), Query Frame = 0 Query: 35 VVDQDLM--DTWYPDCRECTCCKGYKHGCKTPSCAEAGICFCS 75 +V++ L + W+PD CTCCKG+KHGCK C +C CS Sbjct: 132 LVEKHLARREEWFPDATNCTCCKGFKHGCKNSICKSLAVCRCS 174 The following BLAST results are available for this feature:
BLAST of mRNA_H-paniculata_contig9996.17571.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_H-paniculata_contig9996.17571.1 ID=prot_H-paniculata_contig9996.17571.1|Name=mRNA_H-paniculata_contig9996.17571.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=polypeptide|length=117bpback to top |