Homology
The following BLAST results are available for this feature:
BLAST of mRNA_H-paniculata_contig952.17249.1 vs. uniprot
Analysis Date: 2022-09-16 ( Diamond blastp: OGS1.0 vs UniRef90)
Total hits: 0
Match Name | E-value | Identity | Description | |
back to top
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
IPR Term | IPR Description | Source | Source Term | Source Description | Alignment |
None | No IPR available | COILS | Coil | Coil | coord: 83..103 |
None | No IPR available | COILS | Coil | Coil | coord: 107..115 |
None | No IPR available | PFAM | PF14223 | Retrotran_gag_2 | coord: 17..115 e-value: 5.6E-15 score: 55.2 |
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_H-paniculata_contig952.17249.1 ID=prot_H-paniculata_contig952.17249.1|Name=mRNA_H-paniculata_contig952.17249.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=polypeptide|length=115bp DRRGPSDAEPQRVRNTQKAWITLITTCKDMALKITESPSVGSWRKLQKHY CTNDLKEKSHLLRELIPLRMEPGEESTKFLSRVDRIANDLERLGRTVDED ERNLVIVNELSREYE back to top
|