prot_H-paniculata_contig14972.2954.1 (polypeptide) Halopteris paniculata Hal_grac_a_UBK monoicous
Overview
Homology
BLAST of mRNA_H-paniculata_contig14972.2954.1 vs. uniprot
Match: A0A6H5KV10_9PHAE (Bromo domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KV10_9PHAE) HSP 1 Score: 68.6 bits (166), Expect = 2.600e-10 Identity = 36/46 (78.26%), Postives = 39/46 (84.78%), Query Frame = 0 Query: 75 REERLMAQALYMELQGLPGMSSKEEARRMLKDAIPTMAEVPSPPNS 120 REE L AQA Y EL LPGMSSK+EARRMLKDAIP+MA+VPSPP S Sbjct: 1547 REETLAAQAFYAELLRLPGMSSKKEARRMLKDAIPSMADVPSPPPS 1592 The following BLAST results are available for this feature:
BLAST of mRNA_H-paniculata_contig14972.2954.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_H-paniculata_contig14972.2954.1 ID=prot_H-paniculata_contig14972.2954.1|Name=mRNA_H-paniculata_contig14972.2954.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=polypeptide|length=171bpback to top |