prot_H-paniculata_contig14941.2943.1 (polypeptide) Halopteris paniculata Hal_grac_a_UBK monoicous
Overview
Homology
BLAST of mRNA_H-paniculata_contig14941.2943.1 vs. uniprot
Match: D8LCH9_ECTSI (EsV-1-7 n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LCH9_ECTSI) HSP 1 Score: 67.0 bits (162), Expect = 6.470e-9 Identity = 26/39 (66.67%), Postives = 33/39 (84.62%), Query Frame = 0 Query: 1 MVHVLSKECAHQGCSTRPSYGAPGTKKAEFCARHAEDGM 39 M+HV +K C H GC+TR ++G PG+KKAEFC+RHAEDGM Sbjct: 1 MIHVRAKTCDHVGCTTRANFGVPGSKKAEFCSRHAEDGM 39
BLAST of mRNA_H-paniculata_contig14941.2943.1 vs. uniprot
Match: D8LMB1_ECTSI (EsV-1-7 n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LMB1_ECTSI) HSP 1 Score: 57.0 bits (136), Expect = 3.260e-6 Identity = 22/39 (56.41%), Postives = 29/39 (74.36%), Query Frame = 0 Query: 1 MVHVLSKECAHQGCSTRPSYGAPGTKKAEFCARHAEDGM 39 MV V+++ C H GC+ RPS+G G+KK EFCA+HA GM Sbjct: 1 MVDVVNRRCRHPGCTKRPSFGQDGSKKQEFCAQHAHQGM 39
BLAST of mRNA_H-paniculata_contig14941.2943.1 vs. uniprot
Match: A0A6H5LBM3_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5LBM3_9PHAE) HSP 1 Score: 54.3 bits (129), Expect = 1.380e-5 Identity = 21/33 (63.64%), Postives = 25/33 (75.76%), Query Frame = 0 Query: 7 KECAHQGCSTRPSYGAPGTKKAEFCARHAEDGM 39 + CAH+ C P+YG PGT+KAEFCA HA DGM Sbjct: 15 RRCAHEDCVKHPTYGVPGTRKAEFCAPHALDGM 47 The following BLAST results are available for this feature:
BLAST of mRNA_H-paniculata_contig14941.2943.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 3
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_H-paniculata_contig14941.2943.1 ID=prot_H-paniculata_contig14941.2943.1|Name=mRNA_H-paniculata_contig14941.2943.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=polypeptide|length=803bpback to top |