prot_H-paniculata_contig1494.2941.1 (polypeptide) Halopteris paniculata Hal_grac_a_UBK monoicous
Overview
Homology
BLAST of mRNA_H-paniculata_contig1494.2941.1 vs. uniprot
Match: A0A6H5KK08_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KK08_9PHAE) HSP 1 Score: 78.2 bits (191), Expect = 7.420e-15 Identity = 44/98 (44.90%), Postives = 59/98 (60.20%), Query Frame = 0 Query: 1 MQRARVEPEHATEAVETVHSGRMTYRAAADTFGISVGSLQKRVCGIVGIAGMVDSGTVLSTEEEKCLEDTMKFATARHVGLNRDDLKEVAMVLCSDNR 98 M RARV+PE A +A++ V SG M++R AADT+G++ SL +RV V I V GTVL EEE +ED + A + L R +LKE +C D R Sbjct: 1 MGRARVDPERAQKAIDAVRSGEMSFRVAADTYGLNPTSLHRRVKKEVAIDARVGPGTVLCKEEEDFVEDVLMHAFRHFLLLGRGELKEAVRKICLDGR 98 The following BLAST results are available for this feature:
BLAST of mRNA_H-paniculata_contig1494.2941.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 1
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_H-paniculata_contig1494.2941.1 ID=prot_H-paniculata_contig1494.2941.1|Name=mRNA_H-paniculata_contig1494.2941.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=polypeptide|length=98bpback to top |