prot_H-paniculata_contig14780.2853.1 (polypeptide) Halopteris paniculata Hal_grac_a_UBK monoicous
Overview
Homology
BLAST of mRNA_H-paniculata_contig14780.2853.1 vs. uniprot
Match: D7FYX8_ECTSI (Uncharacterized protein n=2 Tax=Ectocarpus TaxID=2879 RepID=D7FYX8_ECTSI) HSP 1 Score: 55.5 bits (132), Expect = 9.670e-8 Identity = 29/44 (65.91%), Postives = 34/44 (77.27%), Query Frame = 0 Query: 1 MWDAFGAIYRAGGVAGLFRGAGARMAFHAPNTAIAMATFEKAKE 44 M DA YRAGG+AGLF+G+GARMAF AP+ I MA FEK+KE Sbjct: 325 MLDALRRSYRAGGLAGLFKGSGARMAFQAPSIGITMAAFEKSKE 368
BLAST of mRNA_H-paniculata_contig14780.2853.1 vs. uniprot
Match: A0A812QZ45_9DINO (Slc25a37 protein n=1 Tax=Symbiodinium necroappetens TaxID=1628268 RepID=A0A812QZ45_9DINO) HSP 1 Score: 46.2 bits (108), Expect = 4.340e-5 Identity = 24/39 (61.54%), Postives = 28/39 (71.79%), Query Frame = 0 Query: 3 DAFGAIYRAGGVAGLFRGAGARMAFHAPNTAIAMATFEK 41 DA ++R GGV LFRGAGAR AFHAP+T I TFE+ Sbjct: 62 DAMLRLWREGGVRALFRGAGARAAFHAPSTCITFTTFEE 100 The following BLAST results are available for this feature:
BLAST of mRNA_H-paniculata_contig14780.2853.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_H-paniculata_contig14780.2853.1 ID=prot_H-paniculata_contig14780.2853.1|Name=mRNA_H-paniculata_contig14780.2853.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=polypeptide|length=44bpback to top |