prot_H-paniculata_contig145.2697.1 (polypeptide) Halopteris paniculata Hal_grac_a_UBK monoicous
Overview
Homology
BLAST of mRNA_H-paniculata_contig145.2697.1 vs. uniprot
Match: A0A6H5L2E5_9PHAE (SAM domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5L2E5_9PHAE) HSP 1 Score: 84.0 bits (206), Expect = 1.590e-17 Identity = 40/55 (72.73%), Postives = 45/55 (81.82%), Query Frame = 0 Query: 1 MRPPRADVISRFHHGRVDGAALLELTDRDLLHPTEGLGITDTDTRRQILELVDAL 55 MRPPRAD+IS+FH VDG ALL +TDR LLHPTEGLGITD RRQILE +D+L Sbjct: 1264 MRPPRADIISKFHDSGVDGTALLSVTDRYLLHPTEGLGITDEVVRRQILEAMDSL 1318
BLAST of mRNA_H-paniculata_contig145.2697.1 vs. uniprot
Match: D8LSX8_ECTSI (SAM domain-containing protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LSX8_ECTSI) HSP 1 Score: 82.8 bits (203), Expect = 4.060e-17 Identity = 40/55 (72.73%), Postives = 44/55 (80.00%), Query Frame = 0 Query: 1 MRPPRADVISRFHHGRVDGAALLELTDRDLLHPTEGLGITDTDTRRQILELVDAL 55 MRPPRAD+IS+FH VDG ALL +TDR LLHPTEGLGITD RRQILE +D L Sbjct: 1071 MRPPRADIISKFHDSGVDGTALLSVTDRYLLHPTEGLGITDEVVRRQILEAMDFL 1125
BLAST of mRNA_H-paniculata_contig145.2697.1 vs. uniprot
Match: A0A835ZEJ2_9STRA (TRAF-type domain-containing protein n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A835ZEJ2_9STRA) HSP 1 Score: 51.6 bits (122), Expect = 3.990e-6 Identity = 26/40 (65.00%), Postives = 30/40 (75.00%), Query Frame = 0 Query: 16 RVDGAALLELTDRDLLHPTEGLGITDTDTRRQILELVDAL 55 RV+GAALL+LTDRDL HP EGLGI D R +IL V A+ Sbjct: 1198 RVNGAALLDLTDRDLAHPVEGLGIRDGARRERILACVRAM 1237 The following BLAST results are available for this feature:
BLAST of mRNA_H-paniculata_contig145.2697.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 3
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_H-paniculata_contig145.2697.1 ID=prot_H-paniculata_contig145.2697.1|Name=mRNA_H-paniculata_contig145.2697.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=polypeptide|length=57bpback to top |