prot_H-paniculata_contig13912.2400.1 (polypeptide) Halopteris paniculata Hal_grac_a_UBK monoicous
Overview
Homology
BLAST of mRNA_H-paniculata_contig13912.2400.1 vs. uniprot
Match: D8LLR2_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LLR2_ECTSI) HSP 1 Score: 114 bits (285), Expect = 7.620e-22 Identity = 51/60 (85.00%), Postives = 56/60 (93.33%), Query Frame = 0 Query: 904 GLIAVAKYEYMAQGTEQLSFRVGDIVQLHTDQVNAKGWGLGQANGKFGWFPGDFVEMRQT 963 G +AVAKYEY+AQG EQLSFRVGDIVQLHT+++NAKGWGLGQANGK GWFPGDFVEMR T Sbjct: 1486 GRVAVAKYEYVAQGPEQLSFRVGDIVQLHTEKINAKGWGLGQANGKVGWFPGDFVEMRPT 1545
BLAST of mRNA_H-paniculata_contig13912.2400.1 vs. uniprot
Match: A0A6H5JEL9_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JEL9_9PHAE) HSP 1 Score: 95.9 bits (237), Expect = 3.550e-16 Identity = 45/55 (81.82%), Postives = 50/55 (90.91%), Query Frame = 0 Query: 917 GTEQLSFRVGDIVQLHTDQVNAKGWGLGQANGKFGWFPGDFVEMRQTSTVDRKSR 971 G EQLSFRVGDIVQLHTD++NAKGWGLGQANGK GWFPGDFVEMR T + +RK+R Sbjct: 1729 GPEQLSFRVGDIVQLHTDKINAKGWGLGQANGKVGWFPGDFVEMRPTPS-ERKAR 1782
BLAST of mRNA_H-paniculata_contig13912.2400.1 vs. uniprot
Match: A0A8C9RAP0_SCLFO (Guanine nucleotide exchange factor VAV3-like n=8 Tax=Scleropages formosus TaxID=113540 RepID=A0A8C9RAP0_SCLFO) HSP 1 Score: 58.5 bits (140), Expect = 7.200e-5 Identity = 24/54 (44.44%), Postives = 38/54 (70.37%), Query Frame = 0 Query: 906 IAVAKYEYMAQGTEQLSFRVGDIVQLHTDQVNAKGWGLGQANGKFGWFPGDFVE 959 IA+A+Y+Y A+ T +LS D+V+++T ++ A GW G+ NG+ GWFP +VE Sbjct: 785 IAIARYDYSARDTRELSLAEDDVVKIYT-KLGANGWWKGEVNGRVGWFPSTYVE 837 The following BLAST results are available for this feature:
BLAST of mRNA_H-paniculata_contig13912.2400.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 3
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_H-paniculata_contig13912.2400.1 ID=prot_H-paniculata_contig13912.2400.1|Name=mRNA_H-paniculata_contig13912.2400.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=polypeptide|length=1051bpback to top |