prot_H-paniculata_contig11734.1112.1 (polypeptide) Halopteris paniculata Hal_grac_a_UBK monoicous
Overview
Homology
BLAST of mRNA_H-paniculata_contig11734.1112.1 vs. uniprot
Match: A0A6H5JVQ3_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JVQ3_9PHAE) HSP 1 Score: 79.3 bits (194), Expect = 4.260e-12 Identity = 39/64 (60.94%), Postives = 44/64 (68.75%), Query Frame = 0 Query: 437 AETAADGRDGKAG--------AAPRLRTFQEKLGQGEKKWWPWAYEVLVVQWTQVLATVDGRVQ 492 A AADG DG A + RLRTF+EKL QGEKKWWPW YEVLVVQWT+VLAT G ++ Sbjct: 21 ATAAADGADGGAAEGSKSSGSGSVRLRTFEEKLNQGEKKWWPWLYEVLVVQWTEVLATARGGME 84
BLAST of mRNA_H-paniculata_contig11734.1112.1 vs. uniprot
Match: D8LBX9_ECTSI (Similar to dedicator of cytokinesis n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LBX9_ECTSI) HSP 1 Score: 75.9 bits (185), Expect = 1.090e-10 Identity = 33/52 (63.46%), Postives = 38/52 (73.08%), Query Frame = 0 Query: 441 ADGRDGKAGAAPRLRTFQEKLGQGEKKWWPWAYEVLVVQWTQVLATVDGRVQ 492 A+G + RLRTF+EKL QGEKKWWPW YEVLVVQWT+VLAT G + Sbjct: 973 AEGTRSSGSGSVRLRTFEEKLNQGEKKWWPWLYEVLVVQWTEVLATARGGTE 1024 The following BLAST results are available for this feature:
BLAST of mRNA_H-paniculata_contig11734.1112.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_H-paniculata_contig11734.1112.1 ID=prot_H-paniculata_contig11734.1112.1|Name=mRNA_H-paniculata_contig11734.1112.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=polypeptide|length=498bpback to top |