prot_H-paniculata_contig11681.1075.1 (polypeptide) Halopteris paniculata Hal_grac_a_UBK monoicous
Overview
Homology
BLAST of mRNA_H-paniculata_contig11681.1075.1 vs. uniprot
Match: A0A6H5JWF9_9PHAE (Integrase catalytic domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JWF9_9PHAE) HSP 1 Score: 80.5 bits (197), Expect = 4.910e-14 Identity = 44/106 (41.51%), Postives = 66/106 (62.26%), Query Frame = 0 Query: 71 MDRDQDPDDFFFVLDECRQTLGDIGQTVHDERYEDVVLQALPTEYIRVRITSFEKRDFELDGIRHMVHTMYVTNLSRSSNFKPTAGRGTTMQAAGYNDSNVQCNYC 176 M + +DPD FF +++ RQ D+ + + DER+EDV+LQA+ +Y VR TSF R F L+ I+ + +MY+ +LSR+ K AGRG M A+ DS ++C C Sbjct: 1 MAQGEDPDGFFITVEDVRQRPKDMVEIISDERFEDVILQAISNDYDYVRPTSFRVRHFGLEEIKTTMKSMYIDSLSRTWT-KSVAGRGVAMPASN-GDSIIKCFNC 104 The following BLAST results are available for this feature:
BLAST of mRNA_H-paniculata_contig11681.1075.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 1
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_H-paniculata_contig11681.1075.1 ID=prot_H-paniculata_contig11681.1075.1|Name=mRNA_H-paniculata_contig11681.1075.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=polypeptide|length=213bpback to top |