prot_H-paniculata_contig11463.951.1 (polypeptide) Halopteris paniculata Hal_grac_a_UBK monoicous
Overview
Homology
BLAST of mRNA_H-paniculata_contig11463.951.1 vs. uniprot
Match: D7FKL3_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FKL3_ECTSI) HSP 1 Score: 58.5 bits (140), Expect = 1.920e-8 Identity = 35/64 (54.69%), Postives = 41/64 (64.06%), Query Frame = 0 Query: 1 EKRETEGQAEIRASNRGHDALMVQRDLHAASGLEKELKRLHELDRWRRQGPGAADVNLAALRER 64 E+ E E +A RA RG +A M R+ AA +E ELKRL ELDR R GAA+ NLAALRER Sbjct: 242 EREEAEEEAGYRAEERGQEAFMRCRNQRAARVVEAELKRLSELDRQHRLRNGAAETNLAALRER 305 The following BLAST results are available for this feature:
BLAST of mRNA_H-paniculata_contig11463.951.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_H-paniculata_contig11463.951.1 ID=prot_H-paniculata_contig11463.951.1|Name=mRNA_H-paniculata_contig11463.951.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=polypeptide|length=64bpback to top |