Homology
BLAST of mRNA_H-paniculata_contig10594.388.1 vs. uniprot
Match:
D7FTF9_ECTSI (Uncharacterized protein (Fragment) n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FTF9_ECTSI)
HSP 1 Score: 64.3 bits (155), Expect = 4.090e-9
Identity = 38/88 (43.18%), Postives = 55/88 (62.50%), Query Frame = 0
Query: 70 SLPPSLRCDTFPRLVCCQ---LLAMRIPRTSGKVAKCKGFALVRYVEPGAALSAVKKISTIKMGSHQLRACSSTNANKLFIGKLNKTW 154
+LPPS +T ++ Q +++MR+ T + KC G ALVR+ A A++++ IKM S++L A SS+NAN LFIG LNKTW
Sbjct: 256 NLPPSATEETVKKVAEEQGGEVVSMRVMMTKDEEPKCAGLALVRFQNRDHAARALERLPEIKMESNKLEARSSSNANTLFIGNLNKTW 343
The following BLAST results are available for this feature:
BLAST of mRNA_H-paniculata_contig10594.388.1 vs. uniprot
Analysis Date: 2022-09-16 (
Diamond blastp: OGS1.0 vs UniRef90 )
Total hits: 1
M K N R F S I V F K L W R E G R S L V A T V S G T A P P T V E R D V R A L C V V F V L A C F L F R C A C V L V F S P R S F V S V V S L P P S L P P S L R C D T F P R L V C C Q L L A M R I P R T S G K V A K C K G F A L V R Y V E P G A A L S A V K K I S T I K M G S H Q L R A C S S T N A N K L F I G K L N K T W 20 40 60 80 100 120 140 Expect = 4.09e-9 / Id = 43.18 Sequence D7FTF9_ECTSI
Match Name E-value Identity Description
D7FTF9_ECTSI 4.090e-9 43.18 Uncharacterized protein (Fragment) n=1 Tax=Ectocar... [more]
back to top
InterPro
Analysis Name:
InterProScan on OGS1.0
Date Performed: 2022-09-29
M K N R F S I V F K L W R E G R S L V A T V S G T A P P T V E R D V R A L C V V F V L A C F L F R C A C V L V F S P R S F V S V V S L P P S L P P S L R C D T F P R L V C C Q L L A M R I P R T S G K V A K C K G F A L V R Y V E P G A A L S A V K K I S T I K M G S H Q L R A C S S T N A N K L F I G K L N K T W 20 40 60 80 100 120 140 Score = Score = Score = Score = Score = Sequence CYTOPLASMIC_DOMAIN TRANSMEMBRANE NON_CYTOPLASMIC_DOMAIN TMhelix SSF54928
IPR Term IPR Description Source Source Term Source Description Alignment
None No IPR available PHOBIUS CYTOPLASMIC_DOMAIN Cytoplasmic domain coord: 57..154 None No IPR available PHOBIUS TRANSMEMBRANE Transmembrane region coord: 34..56 None No IPR available PHOBIUS NON_CYTOPLASMIC_DOMAIN Non cytoplasmic domain coord: 1..33 None No IPR available TMHMM TMhelix coord: 36..58 IPR035979 RNA-binding domain superfamily SUPERFAMILY 54928 RNA-binding domain, RBD coord: 101..142
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence
>prot_H-paniculata_contig10594.388.1 ID=prot_H-paniculata_contig10594.388.1|Name=mRNA_H-paniculata_contig10594.388.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=polypeptide|length=154bp back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: INTERPRO
Term Definition
IPR035979 RBD_domain_sf