prot_H-paniculata_contig10552.365.1 (polypeptide) Halopteris paniculata Hal_grac_a_UBK monoicous
Overview
Homology
BLAST of mRNA_H-paniculata_contig10552.365.1 vs. uniprot
Match: A0A6H5K0I5_9PHAE (Uncharacterized protein (Fragment) n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5K0I5_9PHAE) HSP 1 Score: 87.0 bits (214), Expect = 5.110e-16 Identity = 50/67 (74.63%), Postives = 55/67 (82.09%), Query Frame = 0 Query: 117 GAGSPTTGLTVREERYKRELEGLRTRVRELEGMMECRLEERERAYRRKLRAAVAECRSLKVREHGAV 183 GA GLT E+RYKRELE LR RV ELEGM+ RLEERERAYRRKLRAAVAECRSL+VR+HGA+ Sbjct: 2096 GADDADPGLTDTEKRYKRELEALRGRVWELEGMVAGRLEERERAYRRKLRAAVAECRSLRVRKHGAL 2162
BLAST of mRNA_H-paniculata_contig10552.365.1 vs. uniprot
Match: D8LJM5_ECTSI (Kinesin family member 3A n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LJM5_ECTSI) HSP 1 Score: 82.0 bits (201), Expect = 2.720e-14 Identity = 48/65 (73.85%), Postives = 52/65 (80.00%), Query Frame = 0 Query: 117 GAGSPTTGLTVREERYKRELEGLRTRVRELEGMMECRLEERERAYRRKLRAAVAECRSLKVREHG 181 GA GLT E+RYKRELE LR RV ELEGM+ RLEERERAYRRKLRAAVAECRS +VR+HG Sbjct: 2720 GADDADPGLTDTEKRYKRELEALRGRVWELEGMVGGRLEERERAYRRKLRAAVAECRSSRVRKHG 2784 The following BLAST results are available for this feature:
BLAST of mRNA_H-paniculata_contig10552.365.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_H-paniculata_contig10552.365.1 ID=prot_H-paniculata_contig10552.365.1|Name=mRNA_H-paniculata_contig10552.365.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=polypeptide|length=227bpback to top |