prot_H-paniculata_contig10539.352.1 (polypeptide) Halopteris paniculata Hal_grac_a_UBK monoicous
Overview
Homology
BLAST of mRNA_H-paniculata_contig10539.352.1 vs. uniprot
Match: D7G1T8_ECTSI (Thioredoxin domain-containing protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G1T8_ECTSI) HSP 1 Score: 93.6 bits (231), Expect = 1.560e-21 Identity = 44/53 (83.02%), Postives = 49/53 (92.45%), Query Frame = 0 Query: 1 QVKILPTVICFIDGIAVHHIIGFEGLTAGLAADKLDEWPVSALARELALAKVL 53 QVKILPTVICFIDG+AVH+IIGF+GLTAGL DKLDEWP+S LARELALAK + Sbjct: 228 QVKILPTVICFIDGVAVHNIIGFDGLTAGLPPDKLDEWPLSNLARELALAKAI 280
BLAST of mRNA_H-paniculata_contig10539.352.1 vs. uniprot
Match: A0A482RU92_9ARCH (Uncharacterized protein n=1 Tax=archaeon TaxID=1906665 RepID=A0A482RU92_9ARCH) HSP 1 Score: 58.5 bits (140), Expect = 1.380e-8 Identity = 25/46 (54.35%), Postives = 32/46 (69.57%), Query Frame = 0 Query: 2 VKILPTVICFIDGIAVHHIIGFEGLTAGLAADKLDEWPVSALAREL 47 ++ +PTV+CF+DGIA ++GFEGLT GL DEWP LAR L Sbjct: 244 IRTMPTVVCFVDGIAQDKVVGFEGLTEGLEEGHEDEWPTVRLARLL 289
BLAST of mRNA_H-paniculata_contig10539.352.1 vs. uniprot
Match: A0A835YQ77_9STRA (Thioredoxin-like protein n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A835YQ77_9STRA) HSP 1 Score: 54.3 bits (129), Expect = 4.330e-7 Identity = 27/53 (50.94%), Postives = 33/53 (62.26%), Query Frame = 0 Query: 1 QVKILPTVICFIDGIAVHHIIGFEGLTAGLAADKLDEWPVSALARELALAKVL 53 QV++LP V+ F DGI+V I GFEGL DEWP LA+ LALAK + Sbjct: 231 QVRVLPCVVIFRDGISVAQIQGFEGLNEEQEKGTEDEWPTGNLAKRLALAKAI 283
BLAST of mRNA_H-paniculata_contig10539.352.1 vs. uniprot
Match: J9IP16_9SPIT (Thioredoxin domain-containing protein n=1 Tax=Oxytricha trifallax TaxID=1172189 RepID=J9IP16_9SPIT) HSP 1 Score: 52.0 bits (123), Expect = 2.460e-6 Identity = 26/53 (49.06%), Postives = 36/53 (67.92%), Query Frame = 0 Query: 1 QVKILPTVICFIDGIAVHHIIGFEGLTAGLAADKLDEWPVSALARELALAKVL 53 QV++LPT+ICFIDG+AV ++GFE L A D++P+ AL R L + VL Sbjct: 177 QVQVLPTIICFIDGVAVDRVVGFEDLGAK------DDFPMIALTRRLIRSGVL 223
BLAST of mRNA_H-paniculata_contig10539.352.1 vs. uniprot
Match: F0YBM5_AURAN (Thioredoxin domain-containing protein (Fragment) n=1 Tax=Aureococcus anophagefferens TaxID=44056 RepID=F0YBM5_AURAN) HSP 1 Score: 50.4 bits (119), Expect = 3.970e-6 Identity = 24/50 (48.00%), Postives = 34/50 (68.00%), Query Frame = 0 Query: 1 QVKILPTVICFIDGIAVHHIIGFEGLTAGLAADKLDEWPVSALARELALA 50 QV+++PTV+ F DG+A ++GF+GLT GLA K +E+ AL LA A Sbjct: 100 QVQVMPTVVIFKDGVATARLVGFDGLTEGLAPGKENEFRTDALESWLARA 149
BLAST of mRNA_H-paniculata_contig10539.352.1 vs. uniprot
Match: A0A077ZT00_STYLE (Phosducin-like protein 3 isoform 1 n=1 Tax=Stylonychia lemnae TaxID=5949 RepID=A0A077ZT00_STYLE) HSP 1 Score: 49.7 bits (117), Expect = 1.670e-5 Identity = 27/53 (50.94%), Postives = 35/53 (66.04%), Query Frame = 0 Query: 1 QVKILPTVICFIDGIAVHHIIGFEGLTAGLAADKLDEWPVSALARELALAKVL 53 QV++LPT+ICFIDGIAV I+GFE L A D++P +L R L + VL Sbjct: 174 QVQVLPTMICFIDGIAVDRIVGFEDLGAR------DDFPQISLTRRLIRSGVL 220
BLAST of mRNA_H-paniculata_contig10539.352.1 vs. uniprot
Match: A0A7S3FU40_9SPIT (Hypothetical protein (Fragment) n=1 Tax=Strombidium rassoulzadegani TaxID=1082188 RepID=A0A7S3FU40_9SPIT) HSP 1 Score: 47.0 bits (110), Expect = 4.260e-5 Identity = 21/47 (44.68%), Postives = 30/47 (63.83%), Query Frame = 0 Query: 1 QVKILPTVICFIDGIAVHHIIGFEGLTAGLAADKLDEWPVSALAREL 47 QV++LPT++CF+DGIA+ ++GFE L DE+P L R L Sbjct: 71 QVQVLPTIVCFVDGIALDRVVGFEELGGN------DEFPTLLLTRRL 111
BLAST of mRNA_H-paniculata_contig10539.352.1 vs. uniprot
Match: A0A8J8SZW4_HALGN (Thioredoxin domain-containing protein n=1 Tax=Halteria grandinella TaxID=5974 RepID=A0A8J8SZW4_HALGN) HSP 1 Score: 47.8 bits (112), Expect = 4.990e-5 Identity = 22/47 (46.81%), Postives = 31/47 (65.96%), Query Frame = 0 Query: 1 QVKILPTVICFIDGIAVHHIIGFEGLTAGLAADKLDEWPVSALAREL 47 Q+++LPT+ICFIDGIAV ++GFE + D++P AL R L Sbjct: 95 QIQVLPTIICFIDGIAVDRVVGFEDM------GNRDDFPQIALTRRL 135
BLAST of mRNA_H-paniculata_contig10539.352.1 vs. uniprot
Match: A0A7J6MPG4_PERCH (Thioredoxin domain-containing protein n=1 Tax=Perkinsus chesapeaki TaxID=330153 RepID=A0A7J6MPG4_PERCH) HSP 1 Score: 48.5 bits (114), Expect = 5.060e-5 Identity = 25/54 (46.30%), Postives = 36/54 (66.67%), Query Frame = 0 Query: 1 QVKILPTVICFIDGIAVHHIIGFEGLTAGLAADKLDEWPVSALARELALAKVLY 54 +V++LPT + F+ GIAVHHI+GFEGL +D +++L+ LAKVLY Sbjct: 213 RVRVLPTTVLFVKGIAVHHIVGFEGLRC------IDGEDITSLS----LAKVLY 256
BLAST of mRNA_H-paniculata_contig10539.352.1 vs. uniprot
Match: A0A7S3H0T6_9STRA (Hypothetical protein n=1 Tax=Spumella elongata TaxID=89044 RepID=A0A7S3H0T6_9STRA) HSP 1 Score: 47.8 bits (112), Expect = 9.040e-5 Identity = 20/47 (42.55%), Postives = 30/47 (63.83%), Query Frame = 0 Query: 2 VKILPTVICFIDGIAVHHIIGFEGLTAGLAADKLDEWPVSALARELA 48 ++ +PTV+ F+DG+A+ I+GFE L + + D WP LAR LA Sbjct: 195 IRTMPTVVIFLDGVAIDKILGFEELADSMPPGQEDSWPTIVLARLLA 241 The following BLAST results are available for this feature:
BLAST of mRNA_H-paniculata_contig10539.352.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 10
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_H-paniculata_contig10539.352.1 ID=prot_H-paniculata_contig10539.352.1|Name=mRNA_H-paniculata_contig10539.352.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=polypeptide|length=58bpback to top |