mRNA_H-paniculata_contig964.17332.1 (mRNA) Halopteris paniculata Hal_grac_a_UBK monoicous
You are viewing an mRNA, more information available on the corresponding polypeptide page
Overview
Homology
BLAST of mRNA_H-paniculata_contig964.17332.1 vs. uniprot
Match: D8LU68_ECTSI (Heat Shock transcription factor (Partial) (Fragment) n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LU68_ECTSI) HSP 1 Score: 71.2 bits (173), Expect = 1.170e-8 Identity = 47/126 (37.30%), Postives = 59/126 (46.83%), Query Frame = 3 Query: 930 FPIDLHHILQEEDSTVIGWIEPKRTPSPRSLCEDAFFIRDPERFCVDIMPRYFSQLHHYSRGEYAEHHNTCQAGRMLWVFEIELCLHGFRKTVAHYDVRGRAVAGYTHLSFKRGKPELLVQIQRSI 1307 F + L IL+ ED VIGW S AF I D E+FC +IMPR+F Q + S F+ +L L+GFRK V RG GY H F+RGKPE L Q++R Sbjct: 52 FALGLFQILKTEDPKVIGW----------SASGKAFRIGDSEKFCKEIMPRFFKQNKYSS-------------------FQRQLNLYGFRKLV-----RGNEAGGYMHPLFERGKPEQLSQVRRGF 143
BLAST of mRNA_H-paniculata_contig964.17332.1 vs. uniprot
Match: A0A6H5JLW3_9PHAE (HSF_DOMAIN domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JLW3_9PHAE) HSP 1 Score: 71.2 bits (173), Expect = 1.740e-8 Identity = 47/126 (37.30%), Postives = 59/126 (46.83%), Query Frame = 3 Query: 930 FPIDLHHILQEEDSTVIGWIEPKRTPSPRSLCEDAFFIRDPERFCVDIMPRYFSQLHHYSRGEYAEHHNTCQAGRMLWVFEIELCLHGFRKTVAHYDVRGRAVAGYTHLSFKRGKPELLVQIQRSI 1307 F + L IL+ ED VIGW S AF I D E+FC +IMPR+F Q + S F+ +L L+GFRK V RG GY H F+RGKPE L Q++R Sbjct: 29 FALGLFQILKTEDPKVIGW----------SASGKAFRIGDSEKFCKEIMPRFFKQNKYSS-------------------FQRQLNLYGFRKLV-----RGNEAGGYMHPLFERGKPEQLSQVRRGF 120 The following BLAST results are available for this feature:
BLAST of mRNA_H-paniculata_contig964.17332.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 2 ZOOMx 1POSITION0
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_H-paniculata_contig964.17332.1 >prot_H-paniculata_contig964.17332.1 ID=prot_H-paniculata_contig964.17332.1|Name=mRNA_H-paniculata_contig964.17332.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=polypeptide|length=836bp MGDASTSASASASARTSASGETSANSESREDSRRHKPQPVNSQPGIAKQFback to top mRNA from alignment at H-paniculata_contig964:185..6691+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_H-paniculata_contig964.17332.1 ID=mRNA_H-paniculata_contig964.17332.1|Name=mRNA_H-paniculata_contig964.17332.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=mRNA|length=6507bp|location=Sequence derived from alignment at H-paniculata_contig964:185..6691+ (Halopteris paniculata Hal_grac_a_UBK monoicous)back to top Coding sequence (CDS) from alignment at H-paniculata_contig964:185..6691+ >mRNA_H-paniculata_contig964.17332.1 ID=mRNA_H-paniculata_contig964.17332.1|Name=mRNA_H-paniculata_contig964.17332.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=CDS|length=5016bp|location=Sequence derived from alignment at H-paniculata_contig964:185..6691+ (Halopteris paniculata Hal_grac_a_UBK monoicous)back to top |