mRNA_H-paniculata_contig9600.17307.1 (mRNA) Halopteris paniculata Hal_grac_a_UBK monoicous
You are viewing an mRNA, more information available on the corresponding polypeptide page
Overview
Homology
BLAST of mRNA_H-paniculata_contig9600.17307.1 vs. uniprot
Match: A0A2G8KJ37_STIJA (DEAD domain-containing protein n=1 Tax=Stichopus japonicus TaxID=307972 RepID=A0A2G8KJ37_STIJA) HSP 1 Score: 56.6 bits (135), Expect = 5.950e-7 Identity = 29/70 (41.43%), Postives = 40/70 (57.14%), Query Frame = 1 Query: 127 SGQGSHVDPAKDTDVEKQLESHQLKLSFYGVPEQLVDSYKKRGVEQLFPWQAHCLRVDNCKPCAGGNLVY 336 +GQ S + P + E L LS +G+PE +++ Y GV+ +FPWQA CLR CK GGNL+Y Sbjct: 285 NGQRSPISPPPTSTQEC------LSLSSWGLPEAVLNQYYLMGVQNMFPWQAQCLR--KCKVLQGGNLIY 346
BLAST of mRNA_H-paniculata_contig9600.17307.1 vs. uniprot
Match: A0A5E4M187_9HEMI (DNA-directed DNA polymerase, family A, palm domain,Helicase, C-terminal,Ribonuclease H-like n=2 Tax=Cinara cedri TaxID=506608 RepID=A0A5E4M187_9HEMI) HSP 1 Score: 53.5 bits (127), Expect = 8.030e-6 Identity = 23/45 (51.11%), Postives = 29/45 (64.44%), Query Frame = 1 Query: 202 LSFYGVPEQLVDSYKKRGVEQLFPWQAHCLRVDNCKPCAGGNLVY 336 L +G+P Q+VD+YKKRG+ +FPWQ CL D G NLVY Sbjct: 8 LDSWGLPPQIVDNYKKRGIVSMFPWQVECLTCDGVLD--GQNLVY 50
BLAST of mRNA_H-paniculata_contig9600.17307.1 vs. uniprot
Match: J9M4Q5_ACYPI (Uncharacterized protein n=13 Tax=Aphidinae TaxID=133076 RepID=J9M4Q5_ACYPI) HSP 1 Score: 52.0 bits (123), Expect = 2.780e-5 Identity = 21/45 (46.67%), Postives = 30/45 (66.67%), Query Frame = 1 Query: 202 LSFYGVPEQLVDSYKKRGVEQLFPWQAHCLRVDNCKPCAGGNLVY 336 + +G+P+Q+V++YKKRG+ +FPWQ CL D G NLVY Sbjct: 8 IDSWGLPDQIVENYKKRGIVSMFPWQVECLTSDGVLD--GRNLVY 50
BLAST of mRNA_H-paniculata_contig9600.17307.1 vs. uniprot
Match: UPI0007637EF3 (DNA polymerase theta n=1 Tax=Diuraphis noxia TaxID=143948 RepID=UPI0007637EF3) HSP 1 Score: 50.8 bits (120), Expect = 7.120e-5 Identity = 20/45 (44.44%), Postives = 30/45 (66.67%), Query Frame = 1 Query: 202 LSFYGVPEQLVDSYKKRGVEQLFPWQAHCLRVDNCKPCAGGNLVY 336 + +G+P+Q+V++YK+RG+ +FPWQ CL D G NLVY Sbjct: 8 IDSWGLPDQIVENYKRRGIVSMFPWQVECLTSDGVLD--GRNLVY 50
BLAST of mRNA_H-paniculata_contig9600.17307.1 vs. uniprot
Match: UPI000673F895 (LOW QUALITY PROTEIN: DNA polymerase theta-like n=1 Tax=Biomphalaria glabrata TaxID=6526 RepID=UPI000673F895) HSP 1 Score: 50.8 bits (120), Expect = 7.130e-5 Identity = 22/45 (48.89%), Postives = 29/45 (64.44%), Query Frame = 1 Query: 202 LSFYGVPEQLVDSYKKRGVEQLFPWQAHCLRVDNCKPCAGGNLVY 336 LS +G+PE ++D YKK+G+ +F WQA CL N G NLVY Sbjct: 250 LSSWGLPEPVLDVYKKQGISTMFEWQAECLLTGNA--LGGDNLVY 292 The following BLAST results are available for this feature:
BLAST of mRNA_H-paniculata_contig9600.17307.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 5 ZOOMx 1POSITION0
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following polypeptide feature(s) derives from this mRNA:
The following CDS feature(s) are a part of this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_H-paniculata_contig9600.17307.1 >prot_H-paniculata_contig9600.17307.1 ID=prot_H-paniculata_contig9600.17307.1|Name=mRNA_H-paniculata_contig9600.17307.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=polypeptide|length=116bp YISLKGLKLEGADAYKAFEEDKAKLRSNGGRRVMDGSTILRGSGQGSHVDback to top mRNA from alignment at H-paniculata_contig9600:5991..6906+ Legend: polypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_H-paniculata_contig9600.17307.1 ID=mRNA_H-paniculata_contig9600.17307.1|Name=mRNA_H-paniculata_contig9600.17307.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=mRNA|length=916bp|location=Sequence derived from alignment at H-paniculata_contig9600:5991..6906+ (Halopteris paniculata Hal_grac_a_UBK monoicous)back to top Coding sequence (CDS) from alignment at H-paniculata_contig9600:5991..6906+ >mRNA_H-paniculata_contig9600.17307.1 ID=mRNA_H-paniculata_contig9600.17307.1|Name=mRNA_H-paniculata_contig9600.17307.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=CDS|length=696bp|location=Sequence derived from alignment at H-paniculata_contig9600:5991..6906+ (Halopteris paniculata Hal_grac_a_UBK monoicous)back to top |