mRNA_H-paniculata_contig1505.2999.1 (mRNA) Halopteris paniculata Hal_grac_a_UBK monoicous
Overview
Homology
BLAST of mRNA_H-paniculata_contig1505.2999.1 vs. uniprot
Match: A0A6H5JXN7_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JXN7_9PHAE) HSP 1 Score: 53.5 bits (127), Expect = 2.000e-5 Identity = 17/52 (32.69%), Postives = 32/52 (61.54%), Query Frame = -2 Query: 234 YFNAVWKQAHPTVRLKSGSGFIKCDECVRFNQMLHGSRGVQAVRGSTARGEV 389 YFN +W++ P ++L F+KC +C N+ LHG+ G++ ++ + R E+ Sbjct: 32 YFNQIWREERPLIKLARFGDFMKCSDCTEINEKLHGAPGIRPIQDTRQRAEI 83 The following BLAST results are available for this feature:
BLAST of mRNA_H-paniculata_contig1505.2999.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following polypeptide feature(s) derives from this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following UTR feature(s) are a part of this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_H-paniculata_contig1505.2999.1 >prot_H-paniculata_contig1505.2999.1 ID=prot_H-paniculata_contig1505.2999.1|Name=mRNA_H-paniculata_contig1505.2999.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=polypeptide|length=96bp MIWSARPVYHPRQLLSTHHTWASTSPLAVEPRTACTPRLPCSIWLNLTHSback to top mRNA from alignment at H-paniculata_contig1505:9101..9659- Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_H-paniculata_contig1505.2999.1 ID=mRNA_H-paniculata_contig1505.2999.1|Name=mRNA_H-paniculata_contig1505.2999.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=mRNA|length=559bp|location=Sequence derived from alignment at H-paniculata_contig1505:9101..9659- (Halopteris paniculata Hal_grac_a_UBK monoicous)back to top Coding sequence (CDS) from alignment at H-paniculata_contig1505:9101..9659- >mRNA_H-paniculata_contig1505.2999.1 ID=mRNA_H-paniculata_contig1505.2999.1|Name=mRNA_H-paniculata_contig1505.2999.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=CDS|length=576bp|location=Sequence derived from alignment at H-paniculata_contig1505:9101..9659- (Halopteris paniculata Hal_grac_a_UBK monoicous)back to top |