mRNA_H-paniculata_contig14986.2962.1 (mRNA) Halopteris paniculata Hal_grac_a_UBK monoicous
Overview
Homology
BLAST of mRNA_H-paniculata_contig14986.2962.1 vs. uniprot
Match: D7FZW2_ECTSI (Dicer-like 3 n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FZW2_ECTSI) HSP 1 Score: 104 bits (259), Expect = 1.400e-24 Identity = 48/61 (78.69%), Postives = 55/61 (90.16%), Query Frame = 1 Query: 1 LQVGHGIRKHDYEAAYKNQKLLLGVPAPALRHSFAQHLIRGEKVMDPDAGVRGRVKVRHYS 183 L VGHG+RK DY+AA K+Q+LLLGVPAPAL+HSFAQHL+RGEKVMDPDAGVR RVKV+ S Sbjct: 953 LAVGHGVRKPDYDAADKSQRLLLGVPAPALKHSFAQHLVRGEKVMDPDAGVRSRVKVKRPS 1013
BLAST of mRNA_H-paniculata_contig14986.2962.1 vs. uniprot
Match: A0A6H5KQM7_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KQM7_9PHAE) HSP 1 Score: 102 bits (255), Expect = 4.880e-24 Identity = 47/57 (82.46%), Postives = 53/57 (92.98%), Query Frame = 1 Query: 1 LQVGHGIRKHDYEAAYKNQKLLLGVPAPALRHSFAQHLIRGEKVMDPDAGVRGRVKV 171 L VGHG+RK DY+AA K+Q+LLLGVPAPAL+HSFAQHL+RGEKVMDPDAGVR RVKV Sbjct: 1372 LAVGHGVRKPDYDAADKSQRLLLGVPAPALKHSFAQHLVRGEKVMDPDAGVRSRVKV 1428
BLAST of mRNA_H-paniculata_contig14986.2962.1 vs. uniprot
Match: A0A2S1PRV6_FUCSE (Putative dicer (Fragment) n=1 Tax=Fucus serratus TaxID=87148 RepID=A0A2S1PRV6_FUCSE) HSP 1 Score: 88.6 bits (218), Expect = 4.910e-19 Identity = 41/55 (74.55%), Postives = 47/55 (85.45%), Query Frame = 1 Query: 1 LQVGHGIRKHDYEAAYKNQKLLLGVPAPALRHSFAQHLIRGEKVMDPDAGVRGRV 165 L V GI +HDY+AA K+Q+LLLGVP PALRHSF QHL+RGE+VMDPDAGVR RV Sbjct: 659 LAVVRGIHEHDYKAACKSQRLLLGVPVPALRHSFVQHLMRGERVMDPDAGVRRRV 713 The following BLAST results are available for this feature:
BLAST of mRNA_H-paniculata_contig14986.2962.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 3
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_H-paniculata_contig14986.2962.1 >prot_H-paniculata_contig14986.2962.1 ID=prot_H-paniculata_contig14986.2962.1|Name=mRNA_H-paniculata_contig14986.2962.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=polypeptide|length=63bp LQVGHGIRKHDYEAAYKNQKLLLGVPAPALRHSFAQHLIRGEKVMDPDAGback to top mRNA from alignment at H-paniculata_contig14986:271..459- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_H-paniculata_contig14986.2962.1 ID=mRNA_H-paniculata_contig14986.2962.1|Name=mRNA_H-paniculata_contig14986.2962.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=mRNA|length=189bp|location=Sequence derived from alignment at H-paniculata_contig14986:271..459- (Halopteris paniculata Hal_grac_a_UBK monoicous)back to top Coding sequence (CDS) from alignment at H-paniculata_contig14986:271..459- >mRNA_H-paniculata_contig14986.2962.1 ID=mRNA_H-paniculata_contig14986.2962.1|Name=mRNA_H-paniculata_contig14986.2962.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=CDS|length=378bp|location=Sequence derived from alignment at H-paniculata_contig14986:271..459- (Halopteris paniculata Hal_grac_a_UBK monoicous)back to top |