mRNA_H-paniculata_contig14865.2900.1 (mRNA) Halopteris paniculata Hal_grac_a_UBK monoicous
Overview
Homology
BLAST of mRNA_H-paniculata_contig14865.2900.1 vs. uniprot
Match: A0A6H5L197_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5L197_9PHAE) HSP 1 Score: 74.3 bits (181), Expect = 2.050e-10 Identity = 41/84 (48.81%), Postives = 54/84 (64.29%), Query Frame = 3 Query: 945 DINVFHCSFGHANELLILETAKQRGVVLTGELRGCSGGAMAKGLRKSISTGPAPRAVKILGLTNVDTCGPKGVLGVGGVRFMLI 1196 DIN FH S HA E L+ ETAKQRG+VLTG+L C+ A+G R+S+ GP RA K LG ++D CGP V +GG ++ + Sbjct: 80 DINRFHRSLAHACEPLLRETAKQRGIVLTGKLEPCTDCMKAQGRRRSVPRGPGARASKPLGRVHLDLCGPL-VPSLGGNLYLFV 162
BLAST of mRNA_H-paniculata_contig14865.2900.1 vs. uniprot
Match: A0A6H5LE52_9PHAE (Integrase catalytic domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5LE52_9PHAE) HSP 1 Score: 71.2 bits (173), Expect = 2.170e-9 Identity = 40/84 (47.62%), Postives = 50/84 (59.52%), Query Frame = 3 Query: 945 DINVFHCSFGHANELLILETAKQRGVVLTGELRGCSGGAMAKGLRKSISTGPAPRAVKILGLTNVDTCGPKGVLGVGGVRFMLI 1196 DIN FH S HA E L+ ETA+QRG+ LTG L CS AKG R S+ GP RA K LG ++D CGP +GG ++ + Sbjct: 515 DINRFHRSLAHACEPLLRETARQRGITLTGTLEPCSDCMKAKGKRASVPKGPGARASKPLGRVHLDLCGPLAP-SLGGNLYLFV 597
BLAST of mRNA_H-paniculata_contig14865.2900.1 vs. uniprot
Match: A0A6H5KHU9_9PHAE (Integrase catalytic domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KHU9_9PHAE) HSP 1 Score: 68.2 bits (165), Expect = 1.760e-8 Identity = 38/70 (54.29%), Postives = 42/70 (60.00%), Query Frame = 3 Query: 945 DINVFHCSFGHANELLILETAKQRGVVLTGELRGCSGGAMAKGLRKSISTGPAPRAVKILGLTNVDTCGP 1154 DIN FH S HA E L ETA+QRG+ LTG L CS AKG R S GP RA K LG ++D CGP Sbjct: 76 DINRFHRSLAHACEPLSRETARQRGITLTGTLEPCSDCMKAKGKRSSAPKGPGARASKPLGRVHLDVCGP 145 The following BLAST results are available for this feature:
BLAST of mRNA_H-paniculata_contig14865.2900.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 3
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following polypeptide feature(s) derives from this mRNA:
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_H-paniculata_contig14865.2900.1 >prot_H-paniculata_contig14865.2900.1 ID=prot_H-paniculata_contig14865.2900.1|Name=mRNA_H-paniculata_contig14865.2900.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=polypeptide|length=284bp MDASLWPEYYDRQANDPPISVSNCSVAGVVYPFWVHDAGCKGSFTCRTYGback to top mRNA from alignment at H-paniculata_contig14865:4714..6516+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_H-paniculata_contig14865.2900.1 ID=mRNA_H-paniculata_contig14865.2900.1|Name=mRNA_H-paniculata_contig14865.2900.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=mRNA|length=1803bp|location=Sequence derived from alignment at H-paniculata_contig14865:4714..6516+ (Halopteris paniculata Hal_grac_a_UBK monoicous)back to top Coding sequence (CDS) from alignment at H-paniculata_contig14865:4714..6516+ >mRNA_H-paniculata_contig14865.2900.1 ID=mRNA_H-paniculata_contig14865.2900.1|Name=mRNA_H-paniculata_contig14865.2900.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=CDS|length=1704bp|location=Sequence derived from alignment at H-paniculata_contig14865:4714..6516+ (Halopteris paniculata Hal_grac_a_UBK monoicous)back to top |