mRNA_H-paniculata_contig14328.2614.1 (mRNA) Halopteris paniculata Hal_grac_a_UBK monoicous
Overview
Homology
BLAST of mRNA_H-paniculata_contig14328.2614.1 vs. uniprot
Match: A0A6H5JH58_9PHAE (Reverse transcriptase domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JH58_9PHAE) HSP 1 Score: 66.6 bits (161), Expect = 2.780e-10 Identity = 34/77 (44.16%), Postives = 46/77 (59.74%), Query Frame = -2 Query: 86 AKAVAIATSRDSLAAGGDAAWRPDDEYNPETLITVVESKNALSAAGNGGLRFSHLKYILNAFVSKEGFGPVVGSSWR 316 A A AIA S G WRP++E++P+ LI V+ S+++ S AGN G RFSHLK I N + +E F + S WR Sbjct: 512 AVADAIAESITEEENGSAPRWRPEEEFDPQVLIEVINSRSSNSGAGNDGQRFSHLKSITNTKIGREDFCGAMSSLWR 588 The following BLAST results are available for this feature:
BLAST of mRNA_H-paniculata_contig14328.2614.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_H-paniculata_contig14328.2614.1 >prot_H-paniculata_contig14328.2614.1 ID=prot_H-paniculata_contig14328.2614.1|Name=mRNA_H-paniculata_contig14328.2614.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=polypeptide|length=113bp MLSTRATLQASSCSMEHRQEDPTTGPKPSLLTKAFRMYFRWEKRRPPLPAback to top mRNA from alignment at H-paniculata_contig14328:31..404+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_H-paniculata_contig14328.2614.1 ID=mRNA_H-paniculata_contig14328.2614.1|Name=mRNA_H-paniculata_contig14328.2614.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=mRNA|length=374bp|location=Sequence derived from alignment at H-paniculata_contig14328:31..404+ (Halopteris paniculata Hal_grac_a_UBK monoicous)back to top Coding sequence (CDS) from alignment at H-paniculata_contig14328:31..404+ >mRNA_H-paniculata_contig14328.2614.1 ID=mRNA_H-paniculata_contig14328.2614.1|Name=mRNA_H-paniculata_contig14328.2614.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=CDS|length=678bp|location=Sequence derived from alignment at H-paniculata_contig14328:31..404+ (Halopteris paniculata Hal_grac_a_UBK monoicous)back to top |