mRNA_H-paniculata_contig13789.2329.1 (mRNA) Halopteris paniculata Hal_grac_a_UBK monoicous
Overview
Homology
BLAST of mRNA_H-paniculata_contig13789.2329.1 vs. uniprot
Match: A0A6H5KJL7_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KJL7_9PHAE) HSP 1 Score: 52.0 bits (123), Expect = 1.720e-5 Identity = 24/42 (57.14%), Postives = 30/42 (71.43%), Query Frame = 3 Query: 21 LENYMTLVEESNGFGLTIQLMNEHEDMEIYDKGLDIVNSFVD 146 L Y TLVEE+ GF I L N+H+DMEIYDK +DI+ +F D Sbjct: 196 LSEYTTLVEEAQGFDKIISLANDHDDMEIYDKAMDIIQAFHD 237
BLAST of mRNA_H-paniculata_contig13789.2329.1 vs. uniprot
Match: D7G3N3_ECTSI (Importin alpha-7 subunit, putative n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G3N3_ECTSI) HSP 1 Score: 51.2 bits (121), Expect = 2.850e-5 Identity = 24/45 (53.33%), Postives = 31/45 (68.89%), Query Frame = 3 Query: 21 LENYMTLVEESNGFGLTIQLMNEHEDMEIYDKGLDIVNSFVDESE 155 L Y TLVEE+ GF + L N+H+DMEIYDK +DI+ +F D E Sbjct: 81 LSEYTTLVEEAQGFDKIMGLANDHDDMEIYDKAMDIIQAFHDSQE 125 The following BLAST results are available for this feature:
BLAST of mRNA_H-paniculata_contig13789.2329.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following polypeptide feature(s) derives from this mRNA:
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_H-paniculata_contig13789.2329.1 >prot_H-paniculata_contig13789.2329.1 ID=prot_H-paniculata_contig13789.2329.1|Name=mRNA_H-paniculata_contig13789.2329.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=polypeptide|length=95bp MTLVEESNGFGLTIQLMNEHEDMEIYDKGLDIVNSFVDESELDGASLDSGback to top mRNA from alignment at H-paniculata_contig13789:2474..3230+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_H-paniculata_contig13789.2329.1 ID=mRNA_H-paniculata_contig13789.2329.1|Name=mRNA_H-paniculata_contig13789.2329.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=mRNA|length=757bp|location=Sequence derived from alignment at H-paniculata_contig13789:2474..3230+ (Halopteris paniculata Hal_grac_a_UBK monoicous)back to top Coding sequence (CDS) from alignment at H-paniculata_contig13789:2474..3230+ >mRNA_H-paniculata_contig13789.2329.1 ID=mRNA_H-paniculata_contig13789.2329.1|Name=mRNA_H-paniculata_contig13789.2329.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=CDS|length=570bp|location=Sequence derived from alignment at H-paniculata_contig13789:2474..3230+ (Halopteris paniculata Hal_grac_a_UBK monoicous)back to top |