mRNA_H-paniculata_contig12836.1781.1 (mRNA) Halopteris paniculata Hal_grac_a_UBK monoicous
Overview
Homology
BLAST of mRNA_H-paniculata_contig12836.1781.1 vs. uniprot
Match: D8LRY7_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LRY7_ECTSI) HSP 1 Score: 75.5 bits (184), Expect = 1.120e-14 Identity = 32/47 (68.09%), Postives = 37/47 (78.72%), Query Frame = 1 Query: 10 HRDPVVFVGFRDRVSLSMVTLDTSGLLCVWQYAKEYLSGFGWYKPHK 150 HR V+FVGF+D VSL+MVTLD SGLLCVW Y+ + SGFGWY P K Sbjct: 319 HRHSVIFVGFKDHVSLTMVTLDVSGLLCVWPYSADAFSGFGWYTPSK 365
BLAST of mRNA_H-paniculata_contig12836.1781.1 vs. uniprot
Match: A0A6H5K8K0_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5K8K0_9PHAE) HSP 1 Score: 75.5 bits (184), Expect = 1.120e-14 Identity = 32/47 (68.09%), Postives = 37/47 (78.72%), Query Frame = 1 Query: 10 HRDPVVFVGFRDRVSLSMVTLDTSGLLCVWQYAKEYLSGFGWYKPHK 150 HR V+FVGF+D VSL+MVTLD SGLLCVW Y+ + SGFGWY P K Sbjct: 1180 HRHSVIFVGFKDHVSLTMVTLDVSGLLCVWPYSADAFSGFGWYTPSK 1226
BLAST of mRNA_H-paniculata_contig12836.1781.1 vs. uniprot
Match: UPI0014554ABC (uncharacterized protein LOC117298815 isoform X1 n=2 Tax=Asterias rubens TaxID=7604 RepID=UPI0014554ABC) HSP 1 Score: 52.8 bits (125), Expect = 1.140e-6 Identity = 20/45 (44.44%), Postives = 34/45 (75.56%), Query Frame = 1 Query: 10 HRDPVVFVGFRDRVSLSMVTLDTSGLLCVWQYAKEYLSGFGWYKP 144 H+ P++F+GF +MV++DTSGL+C+W+ +E+ S FGW++P Sbjct: 599 HKSPLMFLGFLGNHG-NMVSMDTSGLICIWESNREWWSHFGWFEP 642
BLAST of mRNA_H-paniculata_contig12836.1781.1 vs. uniprot
Match: A0A2C9LW31_BIOGL (Uncharacterized protein n=2 Tax=Biomphalaria glabrata TaxID=6526 RepID=A0A2C9LW31_BIOGL) HSP 1 Score: 52.0 bits (123), Expect = 2.140e-6 Identity = 20/47 (42.55%), Postives = 31/47 (65.96%), Query Frame = 1 Query: 10 HRDPVVFVGFRDRVSLSMVTLDTSGLLCVWQYAKEYLSGFGWYKPHK 150 H+ P++ + F + M+T+D SGL+C+W+Y K LSGF W+ P K Sbjct: 682 HKHPIIHLDFVGNIG-KMITVDRSGLICLWKYDKAQLSGFDWFLPEK 727 The following BLAST results are available for this feature:
BLAST of mRNA_H-paniculata_contig12836.1781.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 4
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_H-paniculata_contig12836.1781.1 >prot_H-paniculata_contig12836.1781.1 ID=prot_H-paniculata_contig12836.1781.1|Name=mRNA_H-paniculata_contig12836.1781.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=polypeptide|length=50bp RCVHRDPVVFVGFRDRVSLSMVTLDTSGLLCVWQYAKEYLSGFGWYKPHKback to top mRNA from alignment at H-paniculata_contig12836:460..609+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_H-paniculata_contig12836.1781.1 ID=mRNA_H-paniculata_contig12836.1781.1|Name=mRNA_H-paniculata_contig12836.1781.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=mRNA|length=150bp|location=Sequence derived from alignment at H-paniculata_contig12836:460..609+ (Halopteris paniculata Hal_grac_a_UBK monoicous)back to top Coding sequence (CDS) from alignment at H-paniculata_contig12836:460..609+ >mRNA_H-paniculata_contig12836.1781.1 ID=mRNA_H-paniculata_contig12836.1781.1|Name=mRNA_H-paniculata_contig12836.1781.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=CDS|length=300bp|location=Sequence derived from alignment at H-paniculata_contig12836:460..609+ (Halopteris paniculata Hal_grac_a_UBK monoicous)back to top |