mRNA_H-paniculata_contig12716.1704.1 (mRNA) Halopteris paniculata Hal_grac_a_UBK monoicous
Overview
Homology
BLAST of mRNA_H-paniculata_contig12716.1704.1 vs. uniprot
Match: D8LTH9_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LTH9_ECTSI) HSP 1 Score: 72.0 bits (175), Expect = 3.220e-12 Identity = 37/60 (61.67%), Postives = 46/60 (76.67%), Query Frame = -2 Query: 170 SKRRRQLWMREISLNERRYERRKEEARRHFEARQQQLLRWMVNEEAGRHDGLDGNAGPPP 349 S +RRQLW I NE R+ER KE++R ++ RQ++LL WMV+EEAGRHD LDG AGPPP Sbjct: 237 SSQRRQLWALAIRENELRHERMKEDSRSEYDVRQKELLSWMVDEEAGRHDHLDGTAGPPP 296
BLAST of mRNA_H-paniculata_contig12716.1704.1 vs. uniprot
Match: A0A6H5JNI7_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JNI7_9PHAE) HSP 1 Score: 70.5 bits (171), Expect = 1.970e-11 Identity = 36/60 (60.00%), Postives = 45/60 (75.00%), Query Frame = -2 Query: 170 SKRRRQLWMREISLNERRYERRKEEARRHFEARQQQLLRWMVNEEAGRHDGLDGNAGPPP 349 S +RRQLW I NE R+ER KE+ R ++ RQ++L+ WMV+EEAGRHD LDG AGPPP Sbjct: 860 SSQRRQLWALAIRENELRHERMKEDGRSEYDVRQKELVSWMVDEEAGRHDHLDGTAGPPP 919 The following BLAST results are available for this feature:
BLAST of mRNA_H-paniculata_contig12716.1704.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_H-paniculata_contig12716.1704.1 >prot_H-paniculata_contig12716.1704.1 ID=prot_H-paniculata_contig12716.1704.1|Name=mRNA_H-paniculata_contig12716.1704.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=polypeptide|length=110bp MHIVVISLTPPGTPSMPPPPYQFMSSSGGGPAFPSNPSCRPASSFTIHRNback to top mRNA from alignment at H-paniculata_contig12716:77..495+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_H-paniculata_contig12716.1704.1 ID=mRNA_H-paniculata_contig12716.1704.1|Name=mRNA_H-paniculata_contig12716.1704.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=mRNA|length=419bp|location=Sequence derived from alignment at H-paniculata_contig12716:77..495+ (Halopteris paniculata Hal_grac_a_UBK monoicous)back to top Coding sequence (CDS) from alignment at H-paniculata_contig12716:77..495+ >mRNA_H-paniculata_contig12716.1704.1 ID=mRNA_H-paniculata_contig12716.1704.1|Name=mRNA_H-paniculata_contig12716.1704.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=CDS|length=660bp|location=Sequence derived from alignment at H-paniculata_contig12716:77..495+ (Halopteris paniculata Hal_grac_a_UBK monoicous)back to top |