mRNA_H-paniculata_contig1255.1601.1 (mRNA) Halopteris paniculata Hal_grac_a_UBK monoicous
Overview
Homology
BLAST of mRNA_H-paniculata_contig1255.1601.1 vs. uniprot
Match: A0A6H5JHD3_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JHD3_9PHAE) HSP 1 Score: 63.2 bits (152), Expect = 1.450e-9 Identity = 29/46 (63.04%), Postives = 33/46 (71.74%), Query Frame = 2 Query: 104 DPCAGAMAAYLKCVEGKTAGLRDGDECAEEGSEYKACRQRVKAAKR 241 DPC AM AY++CVEGK GLRDGDEC E YK CRQ V+ AK+ Sbjct: 14 DPCLEAMGAYVRCVEGKADGLRDGDECTAEVEAYKKCRQLVREAKK 59 The following BLAST results are available for this feature:
BLAST of mRNA_H-paniculata_contig1255.1601.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following polypeptide feature(s) derives from this mRNA:
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_H-paniculata_contig1255.1601.1 >prot_H-paniculata_contig1255.1601.1 ID=prot_H-paniculata_contig1255.1601.1|Name=mRNA_H-paniculata_contig1255.1601.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=polypeptide|length=74bp MRDDRIDPCAGAMAAYLKCVEGKTAGLRDGDECAEEGSEYKACRQRVKAAback to top mRNA from alignment at H-paniculata_contig1255:245..1543+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_H-paniculata_contig1255.1601.1 ID=mRNA_H-paniculata_contig1255.1601.1|Name=mRNA_H-paniculata_contig1255.1601.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=mRNA|length=1299bp|location=Sequence derived from alignment at H-paniculata_contig1255:245..1543+ (Halopteris paniculata Hal_grac_a_UBK monoicous)back to top Coding sequence (CDS) from alignment at H-paniculata_contig1255:245..1543+ >mRNA_H-paniculata_contig1255.1601.1 ID=mRNA_H-paniculata_contig1255.1601.1|Name=mRNA_H-paniculata_contig1255.1601.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=CDS|length=444bp|location=Sequence derived from alignment at H-paniculata_contig1255:245..1543+ (Halopteris paniculata Hal_grac_a_UBK monoicous)back to top |