mRNA_H-paniculata_contig12269.1445.1 (mRNA) Halopteris paniculata Hal_grac_a_UBK monoicous
Overview
Homology
BLAST of mRNA_H-paniculata_contig12269.1445.1 vs. uniprot
Match: Q7XWZ9_ORYSJ (OSJNBa0079F16.4 protein n=1 Tax=Oryza sativa subsp. japonica TaxID=39947 RepID=Q7XWZ9_ORYSJ) HSP 1 Score: 75.1 bits (183), Expect = 9.320e-14 Identity = 34/63 (53.97%), Postives = 44/63 (69.84%), Query Frame = 1 Query: 1 VRSAVYCLNRAPTRPHNGRTPYEKWHDETPNLDHLRVFGCTAYVMFQLQQRYKLDDKARAGCF 189 V +AVY LNR+PT+ +GRTPYE WH+ P + HLRVFGC A+V +L KLDD++ G F Sbjct: 986 VVTAVYILNRSPTKALDGRTPYEAWHERKPGVSHLRVFGCLAFVK-ELGHIGKLDDRSTPGVF 1047
BLAST of mRNA_H-paniculata_contig12269.1445.1 vs. uniprot
Match: Q0IU13_ORYSJ (Os11g0199800 protein n=1 Tax=Oryza sativa subsp. japonica TaxID=39947 RepID=Q0IU13_ORYSJ) HSP 1 Score: 73.9 bits (180), Expect = 2.320e-13 Identity = 34/63 (53.97%), Postives = 43/63 (68.25%), Query Frame = 1 Query: 1 VRSAVYCLNRAPTRPHNGRTPYEKWHDETPNLDHLRVFGCTAYVMFQLQQRYKLDDKARAGCF 189 V +AVY LNR+PT+ +GRTPYE WH P + HLRVFGC A+V +L KLDD++ G F Sbjct: 782 VVTAVYILNRSPTKALDGRTPYEAWHGRKPGVSHLRVFGCLAFVK-ELGPISKLDDRSTPGVF 843
BLAST of mRNA_H-paniculata_contig12269.1445.1 vs. uniprot
Match: A0A0A9X689_LYGHE (Retrovirus-related Pol polyprotein from transposon TNT 1-94 (Fragment) n=1 Tax=Lygus hesperus TaxID=30085 RepID=A0A0A9X689_LYGHE) HSP 1 Score: 69.3 bits (168), Expect = 2.340e-13 Identity = 32/63 (50.79%), Postives = 39/63 (61.90%), Query Frame = 1 Query: 1 VRSAVYCLNRAPTRPHNGRTPYEKWHDETPNLDHLRVFGCTAYVMFQLQQRYKLDDKARAGCF 189 +AVY +NR+PT+ G TP EKW P+L HLRVFGC AY Q+R KLD K+R F Sbjct: 25 ANTAVYLINRSPTKKLPGVTPEEKWLGNKPDLSHLRVFGCPAYAHIPSQKRKKLDSKSRLLTF 87
BLAST of mRNA_H-paniculata_contig12269.1445.1 vs. uniprot
Match: Q53LP5_ORYSJ (Retrotransposon protein, putative, Ty1-copia sub-class n=1 Tax=Oryza sativa subsp. japonica TaxID=39947 RepID=Q53LP5_ORYSJ) HSP 1 Score: 73.9 bits (180), Expect = 2.370e-13 Identity = 34/63 (53.97%), Postives = 43/63 (68.25%), Query Frame = 1 Query: 1 VRSAVYCLNRAPTRPHNGRTPYEKWHDETPNLDHLRVFGCTAYVMFQLQQRYKLDDKARAGCF 189 V +AVY LNR+PT+ +GRTPYE WH P + HLRVFGC A+V +L KLDD++ G F Sbjct: 834 VVTAVYILNRSPTKALDGRTPYEAWHGRKPGVSHLRVFGCLAFVK-ELGPISKLDDRSTPGVF 895
BLAST of mRNA_H-paniculata_contig12269.1445.1 vs. uniprot
Match: A0A0V1GX97_9BILA (Retrovirus-related Pol polyprotein from transposon TNT 1-94 (Fragment) n=1 Tax=Trichinella zimbabwensis TaxID=268475 RepID=A0A0V1GX97_9BILA) HSP 1 Score: 73.6 bits (179), Expect = 2.800e-13 Identity = 32/63 (50.79%), Postives = 39/63 (61.90%), Query Frame = 1 Query: 1 VRSAVYCLNRAPTRPHNGRTPYEKWHDETPNLDHLRVFGCTAYVMFQLQQRYKLDDKARAGCF 189 V +A Y LNR P R +TPYEKW ++ P ++HLR+FGC AYV Q R K D KAR F Sbjct: 82 VHTAAYLLNRIPNRKETTKTPYEKWFEKRPTVEHLRIFGCDAYVHIPDQHRKKFDRKARKVIF 144
BLAST of mRNA_H-paniculata_contig12269.1445.1 vs. uniprot
Match: A0A0V1GQ65_9BILA (Retrovirus-related Pol polyprotein from transposon TNT 1-94 n=1 Tax=Trichinella zimbabwensis TaxID=268475 RepID=A0A0V1GQ65_9BILA) HSP 1 Score: 72.4 bits (176), Expect = 7.470e-13 Identity = 32/63 (50.79%), Postives = 38/63 (60.32%), Query Frame = 1 Query: 1 VRSAVYCLNRAPTRPHNGRTPYEKWHDETPNLDHLRVFGCTAYVMFQLQQRYKLDDKARAGCF 189 V +A Y LNR P R +TPYEKW + P ++HLR+FGC AYV Q R K D KAR F Sbjct: 211 VHTAAYLLNRIPNRKETTKTPYEKWFGKRPTVEHLRIFGCDAYVHIPDQHRNKFDRKARKVIF 273
BLAST of mRNA_H-paniculata_contig12269.1445.1 vs. uniprot
Match: UPI000DF4E0C1 (uncharacterized protein LOC112892555 n=1 Tax=Panicum hallii TaxID=206008 RepID=UPI000DF4E0C1) HSP 1 Score: 72.4 bits (176), Expect = 8.060e-13 Identity = 39/86 (45.35%), Postives = 51/86 (59.30%), Query Frame = 1 Query: 1 VRSAVYCLNRAPTRPHNGRTPYEKWHDETPNLDHLRVFGCTAYVMFQLQQRYKLDDKARAGCF--WRT-TKTA*VISFITRKTRAS 249 V +AVY LNRAPTR G+TPYE WH + P++DHLR FGC A+V KL D++ F + T TK V +T+K + S Sbjct: 593 VHTAVYLLNRAPTRSLKGKTPYEAWHKKKPSVDHLRTFGCVAHVKKTGPGVTKLSDRSTPMLFVGYETRTKGYRVYDPVTKKLQVS 678
BLAST of mRNA_H-paniculata_contig12269.1445.1 vs. uniprot
Match: A0A0V1M2B3_9BILA (Retrovirus-related Pol polyprotein from transposon TNT 1-94 n=1 Tax=Trichinella papuae TaxID=268474 RepID=A0A0V1M2B3_9BILA) HSP 1 Score: 72.4 bits (176), Expect = 8.100e-13 Identity = 32/63 (50.79%), Postives = 38/63 (60.32%), Query Frame = 1 Query: 1 VRSAVYCLNRAPTRPHNGRTPYEKWHDETPNLDHLRVFGCTAYVMFQLQQRYKLDDKARAGCF 189 V +A Y LNR P R +TPYEKW + P ++HLR+FGC AYV Q R K D KAR F Sbjct: 606 VHTAAYLLNRIPNRKETTKTPYEKWFGKRPTVEHLRIFGCDAYVHIPDQHRKKFDRKARKVIF 668
BLAST of mRNA_H-paniculata_contig12269.1445.1 vs. uniprot
Match: A0A0V1MB43_9BILA (Retrovirus-related Pol polyprotein from transposon TNT 1-94 n=3 Tax=Trichinella TaxID=6333 RepID=A0A0V1MB43_9BILA) HSP 1 Score: 72.4 bits (176), Expect = 8.200e-13 Identity = 32/63 (50.79%), Postives = 38/63 (60.32%), Query Frame = 1 Query: 1 VRSAVYCLNRAPTRPHNGRTPYEKWHDETPNLDHLRVFGCTAYVMFQLQQRYKLDDKARAGCF 189 V +A Y LNR P R +TPYEKW + P ++HLR+FGC AYV Q R K D KAR F Sbjct: 606 VHTAAYLLNRIPNRKETTKTPYEKWFGKRPTVEHLRIFGCDAYVHIPDQHRKKFDRKARKVIF 668
BLAST of mRNA_H-paniculata_contig12269.1445.1 vs. uniprot
Match: A0A4Y2LMC7_ARAVE (Retrovirus-related Pol polyprotein from transposon TNT 1-94 n=39 Tax=Araneus ventricosus TaxID=182803 RepID=A0A4Y2LMC7_ARAVE) HSP 1 Score: 72.4 bits (176), Expect = 8.210e-13 Identity = 34/61 (55.74%), Postives = 40/61 (65.57%), Query Frame = 1 Query: 7 SAVYCLNRAPTRPHNGRTPYEKWHDETPNLDHLRVFGCTAYVMFQLQQRYKLDDKARAGCF 189 +A Y NR PT+P +TPYE W + PNL H+RVFGC AYV Q Q+R KLD KA G F Sbjct: 678 TATYLQNRLPTKPKR-KTPYELWTNLKPNLSHIRVFGCKAYVYIQKQKRGKLDSKAVEGIF 737 The following BLAST results are available for this feature:
BLAST of mRNA_H-paniculata_contig12269.1445.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 25
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_H-paniculata_contig12269.1445.1 >prot_H-paniculata_contig12269.1445.1 ID=prot_H-paniculata_contig12269.1445.1|Name=mRNA_H-paniculata_contig12269.1445.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=polypeptide|length=71bp VRSAVYCLNRAPTRPHNGRTPYEKWHDETPNLDHLRVFGCTAYVMFQLQQback to top mRNA from alignment at H-paniculata_contig12269:583..863- Legend: polypeptideCDSUTR Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_H-paniculata_contig12269.1445.1 ID=mRNA_H-paniculata_contig12269.1445.1|Name=mRNA_H-paniculata_contig12269.1445.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=mRNA|length=281bp|location=Sequence derived from alignment at H-paniculata_contig12269:583..863- (Halopteris paniculata Hal_grac_a_UBK monoicous)back to top Coding sequence (CDS) from alignment at H-paniculata_contig12269:583..863- >mRNA_H-paniculata_contig12269.1445.1 ID=mRNA_H-paniculata_contig12269.1445.1|Name=mRNA_H-paniculata_contig12269.1445.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=CDS|length=426bp|location=Sequence derived from alignment at H-paniculata_contig12269:583..863- (Halopteris paniculata Hal_grac_a_UBK monoicous)back to top |