mRNA_H-paniculata_contig11679.1072.1 (mRNA) Halopteris paniculata Hal_grac_a_UBK monoicous
Overview
Homology
BLAST of mRNA_H-paniculata_contig11679.1072.1 vs. uniprot
Match: A0A6H5K7Y7_9PHAE (Signal peptidase complex subunit 2 n=2 Tax=Ectocarpus TaxID=2879 RepID=A0A6H5K7Y7_9PHAE) HSP 1 Score: 58.9 bits (141), Expect = 5.700e-7 Identity = 25/40 (62.50%), Postives = 30/40 (75.00%), Query Frame = -1 Query: 332 ESWKVGKYFDVEGYFDEWGMGDVAERLVQKLEKKIKDRAK 451 E W VGKYFD EG FDEWGMGD + LV +LEK+ +D+ K Sbjct: 145 EQWHVGKYFDYEGNFDEWGMGDAVKNLVTRLEKRARDKKK 184 The following BLAST results are available for this feature:
BLAST of mRNA_H-paniculata_contig11679.1072.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following polypeptide feature(s) derives from this mRNA:
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_H-paniculata_contig11679.1072.1 >prot_H-paniculata_contig11679.1072.1 ID=prot_H-paniculata_contig11679.1072.1|Name=mRNA_H-paniculata_contig11679.1072.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=polypeptide|length=133bp MTVTNTIIPTAHFSFFSFFFALSLIFFSSFCTSLSATSPMPHSSKYPSTSback to top mRNA from alignment at H-paniculata_contig11679:3850..4609+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_H-paniculata_contig11679.1072.1 ID=mRNA_H-paniculata_contig11679.1072.1|Name=mRNA_H-paniculata_contig11679.1072.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=mRNA|length=760bp|location=Sequence derived from alignment at H-paniculata_contig11679:3850..4609+ (Halopteris paniculata Hal_grac_a_UBK monoicous)back to top Coding sequence (CDS) from alignment at H-paniculata_contig11679:3850..4609+ >mRNA_H-paniculata_contig11679.1072.1 ID=mRNA_H-paniculata_contig11679.1072.1|Name=mRNA_H-paniculata_contig11679.1072.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=CDS|length=798bp|location=Sequence derived from alignment at H-paniculata_contig11679:3850..4609+ (Halopteris paniculata Hal_grac_a_UBK monoicous)back to top |