mRNA_H-paniculata_contig1164.1058.1 (mRNA) Halopteris paniculata Hal_grac_a_UBK monoicous
Overview
Homology
BLAST of mRNA_H-paniculata_contig1164.1058.1 vs. uniprot
Match: D8LE14_ECTSI (TPR Domain containing protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LE14_ECTSI) HSP 1 Score: 96.3 bits (238), Expect = 6.980e-19 Identity = 45/52 (86.54%), Postives = 48/52 (92.31%), Query Frame = 2 Query: 641 MSDYHILAHSSQRSGRHWMEGLAYYSTGVTMDSMGQYGKALESYRKFLAVCK 796 MSDYH+LA SSQRSGRH MEGLAYYS GVTMDSMGQY KALE+Y+KFLAVCK Sbjct: 193 MSDYHMLAFSSQRSGRHEMEGLAYYSAGVTMDSMGQYPKALENYKKFLAVCK 244
BLAST of mRNA_H-paniculata_contig1164.1058.1 vs. uniprot
Match: A0A6H5LCZ2_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5LCZ2_9PHAE) HSP 1 Score: 92.8 bits (229), Expect = 1.150e-17 Identity = 43/52 (82.69%), Postives = 48/52 (92.31%), Query Frame = 2 Query: 641 MSDYHILAHSSQRSGRHWMEGLAYYSTGVTMDSMGQYGKALESYRKFLAVCK 796 MSDY++LA SSQRSGRH MEGLAYYS GVTMDSMGQY KA+E+Y+KFLAVCK Sbjct: 190 MSDYNMLAFSSQRSGRHEMEGLAYYSAGVTMDSMGQYPKAIENYKKFLAVCK 241
BLAST of mRNA_H-paniculata_contig1164.1058.1 vs. uniprot
Match: A0A836C9X6_9STRA (Uncharacterized protein n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A836C9X6_9STRA) HSP 1 Score: 76.6 bits (187), Expect = 2.340e-12 Identity = 34/52 (65.38%), Postives = 43/52 (82.69%), Query Frame = 2 Query: 641 MSDYHILAHSSQRSGRHWMEGLAYYSTGVTMDSMGQYGKALESYRKFLAVCK 796 +SDY +LA SSQR+GR MEGLAY+ GV D+MGQYGKALE+Y+K+L VC+ Sbjct: 94 ISDYTVLASSSQRAGRPQMEGLAYFCIGVLYDNMGQYGKALEAYKKYLGVCR 145
BLAST of mRNA_H-paniculata_contig1164.1058.1 vs. uniprot
Match: A0A7S2C237_9STRA (Hypothetical protein n=1 Tax=Florenciella parvula TaxID=236787 RepID=A0A7S2C237_9STRA) HSP 1 Score: 67.0 bits (162), Expect = 5.790e-9 Identity = 31/58 (53.45%), Postives = 44/58 (75.86%), Query Frame = 2 Query: 641 MSDYHILAHSSQRSGRHWMEGLAYYSTGVTMDSMGQYGKALESYRKFLAVCK*GPEPL 814 +SDY +LA SSQR+G+ MEG AY + +T+D+M QY KA+ESY KFL+VC+ +P+ Sbjct: 157 VSDYSMLAFSSQRAGKTQMEGQAYLAIAITLDNMQQYTKAIESYGKFLSVCEKMGDPV 214 The following BLAST results are available for this feature:
BLAST of mRNA_H-paniculata_contig1164.1058.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 4
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following polypeptide feature(s) derives from this mRNA:
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_H-paniculata_contig1164.1058.1 >prot_H-paniculata_contig1164.1058.1 ID=prot_H-paniculata_contig1164.1058.1|Name=mRNA_H-paniculata_contig1164.1058.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=polypeptide|length=53bp MSDYHILAHSSQRSGRHWMEGLAYYSTGVTMDSMGQYGKALESYRKFLAVback to top mRNA from alignment at H-paniculata_contig1164:26128..26959- Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_H-paniculata_contig1164.1058.1 ID=mRNA_H-paniculata_contig1164.1058.1|Name=mRNA_H-paniculata_contig1164.1058.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=mRNA|length=832bp|location=Sequence derived from alignment at H-paniculata_contig1164:26128..26959- (Halopteris paniculata Hal_grac_a_UBK monoicous)back to top Coding sequence (CDS) from alignment at H-paniculata_contig1164:26128..26959- >mRNA_H-paniculata_contig1164.1058.1 ID=mRNA_H-paniculata_contig1164.1058.1|Name=mRNA_H-paniculata_contig1164.1058.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=CDS|length=318bp|location=Sequence derived from alignment at H-paniculata_contig1164:26128..26959- (Halopteris paniculata Hal_grac_a_UBK monoicous)back to top |