mRNA_H-paniculata_contig10780.495.1 (mRNA) Halopteris paniculata Hal_grac_a_UBK monoicous
Overview
Homology
BLAST of mRNA_H-paniculata_contig10780.495.1 vs. uniprot
Match: D7FU11_ECTSI (BRO1 domain-containing protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FU11_ECTSI) HSP 1 Score: 74.7 bits (182), Expect = 1.060e-12 Identity = 35/44 (79.55%), Postives = 38/44 (86.36%), Query Frame = 3 Query: 75 SELSPNLLKVVTHVYRFPLPATKMIAFTKCFERNMGADETQKTI 206 SELSP LLKV THVYRFPLPATK+IAFTKCF N+GA+ET K I Sbjct: 7 SELSPALLKVATHVYRFPLPATKVIAFTKCFADNLGAEETSKAI 50
BLAST of mRNA_H-paniculata_contig10780.495.1 vs. uniprot
Match: A0A6H5JIM0_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JIM0_9PHAE) HSP 1 Score: 68.9 bits (167), Expect = 1.070e-10 Identity = 34/92 (36.96%), Postives = 55/92 (59.78%), Query Frame = -1 Query: 208 SLSLTHRKNRVDFILDQAPRNRITCRSGFQTIHIEDAWTYLIRDKDRVRMFPGEERVGST*PYSTSHIPKVMFICAVSRPDLSRYFDGRSRI 483 SLS +++R+DFI D+ +H++++W YL+R+K++VR+F GE+ G SH+PK+M I A +RPD + FDG+ I Sbjct: 124 SLSDAQKRHRMDFISDRVDEPIGEYLDQGNVVHLDESWFYLMREKEKVRVFSGEDVPGPPRVPHESHLPKIMVIVANARPDPAHDFDGKIGI 215 The following BLAST results are available for this feature:
BLAST of mRNA_H-paniculata_contig10780.495.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following polypeptide feature(s) derives from this mRNA:
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_H-paniculata_contig10780.495.1 >prot_H-paniculata_contig10780.495.1 ID=prot_H-paniculata_contig10780.495.1|Name=mRNA_H-paniculata_contig10780.495.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=polypeptide|length=68bp MAESSELSPNLLKVVTHVYRFPLPATKMIAFTKCFERNMGADETQKTIRFback to top mRNA from alignment at H-paniculata_contig10780:6442..7996- Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_H-paniculata_contig10780.495.1 ID=mRNA_H-paniculata_contig10780.495.1|Name=mRNA_H-paniculata_contig10780.495.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=mRNA|length=1555bp|location=Sequence derived from alignment at H-paniculata_contig10780:6442..7996- (Halopteris paniculata Hal_grac_a_UBK monoicous)back to top Coding sequence (CDS) from alignment at H-paniculata_contig10780:6442..7996- >mRNA_H-paniculata_contig10780.495.1 ID=mRNA_H-paniculata_contig10780.495.1|Name=mRNA_H-paniculata_contig10780.495.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=CDS|length=408bp|location=Sequence derived from alignment at H-paniculata_contig10780:6442..7996- (Halopteris paniculata Hal_grac_a_UBK monoicous)back to top |