mRNA_H-paniculata_contig10731.463.1 (mRNA) Halopteris paniculata Hal_grac_a_UBK monoicous
Overview
Homology
BLAST of mRNA_H-paniculata_contig10731.463.1 vs. uniprot
Match: D8LNE6_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LNE6_ECTSI) HSP 1 Score: 65.9 bits (159), Expect = 1.810e-12 Identity = 27/45 (60.00%), Postives = 37/45 (82.22%), Query Frame = 1 Query: 1 GDVAEVNRCLAAGEPVDKRDTKRKTPLHCACAGGHYAVVNVLLER 135 G++AEV RCLA GE VDKR+T+R+T LH AC GGH+ V ++L++R Sbjct: 32 GNLAEVQRCLADGEMVDKRNTRRQTALHSACLGGHHEVADILMKR 76
BLAST of mRNA_H-paniculata_contig10731.463.1 vs. uniprot
Match: UPI0013F38C44 (putative ankyrin repeat domain-containing protein 20A5 n=1 Tax=Lontra canadensis TaxID=76717 RepID=UPI0013F38C44) HSP 1 Score: 51.2 bits (121), Expect = 1.630e-6 Identity = 21/45 (46.67%), Postives = 32/45 (71.11%), Query Frame = 1 Query: 1 GDVAEVNRCLAAGEPVDKRDTKRKTPLHCACAGGHYAVVNVLLER 135 G++ ++ R L G+ V+KRD K++TPLH AC GH +V+ L+ER Sbjct: 60 GNILKMRRLLMLGKDVNKRDKKKRTPLHLACTIGHADMVDFLVER 104
BLAST of mRNA_H-paniculata_contig10731.463.1 vs. uniprot
Match: A0A2Y9IJ40_ENHLU (ankyrin repeat domain-containing protein 26 n=1 Tax=Enhydra lutris kenyoni TaxID=391180 RepID=A0A2Y9IJ40_ENHLU) HSP 1 Score: 51.2 bits (121), Expect = 3.350e-6 Identity = 21/45 (46.67%), Postives = 32/45 (71.11%), Query Frame = 1 Query: 1 GDVAEVNRCLAAGEPVDKRDTKRKTPLHCACAGGHYAVVNVLLER 135 G++ ++ R L G+ V+KRD K++TPLH AC GH +V+ L+ER Sbjct: 60 GNILKMQRLLLLGKDVNKRDKKKRTPLHLACTIGHADMVDFLVER 104
BLAST of mRNA_H-paniculata_contig10731.463.1 vs. uniprot
Match: UPI001D1A2DE5 (ankyrin repeat domain-containing protein 26-like n=1 Tax=Mustela putorius furo TaxID=9669 RepID=UPI001D1A2DE5) HSP 1 Score: 49.7 bits (117), Expect = 1.170e-5 Identity = 20/45 (44.44%), Postives = 31/45 (68.89%), Query Frame = 1 Query: 1 GDVAEVNRCLAAGEPVDKRDTKRKTPLHCACAGGHYAVVNVLLER 135 GD+ + + L G+ V+KRD +++TPLH AC GH +V+ L+ER Sbjct: 59 GDIRNMEQLLLRGKNVNKRDKRKRTPLHLACTIGHADMVDFLVER 103
BLAST of mRNA_H-paniculata_contig10731.463.1 vs. uniprot
Match: UPI001D19AB1B (putative ankyrin repeat domain-containing protein 20A5 n=2 Tax=Mustela TaxID=9665 RepID=UPI001D19AB1B) HSP 1 Score: 49.3 bits (116), Expect = 1.400e-5 Identity = 20/45 (44.44%), Postives = 31/45 (68.89%), Query Frame = 1 Query: 1 GDVAEVNRCLAAGEPVDKRDTKRKTPLHCACAGGHYAVVNVLLER 135 GD+ + + L G+ V+KRD +++TPLH AC GH +V+ L+ER Sbjct: 48 GDIRNMEQLLLHGKNVNKRDKRKRTPLHLACTIGHADMVDFLVER 92
BLAST of mRNA_H-paniculata_contig10731.463.1 vs. uniprot
Match: UPI001E6A0B2A (LOW QUALITY PROTEIN: ankyrin repeat domain-containing protein 26-like n=4 Tax=Meles meles TaxID=9662 RepID=UPI001E6A0B2A) HSP 1 Score: 49.3 bits (116), Expect = 1.610e-5 Identity = 19/45 (42.22%), Postives = 31/45 (68.89%), Query Frame = 1 Query: 1 GDVAEVNRCLAAGEPVDKRDTKRKTPLHCACAGGHYAVVNVLLER 135 G++ + + L G+ V+KRD K++TPLH AC GH +V +L+E+ Sbjct: 60 GNILRLQQLLLLGKDVNKRDKKKRTPLHLACTIGHADIVTLLVEK 104
BLAST of mRNA_H-paniculata_contig10731.463.1 vs. uniprot
Match: UPI001386FD61 (ankyrin repeat domain-containing protein 26-like n=1 Tax=Mustela erminea TaxID=36723 RepID=UPI001386FD61) HSP 1 Score: 48.9 bits (115), Expect = 2.190e-5 Identity = 20/45 (44.44%), Postives = 31/45 (68.89%), Query Frame = 1 Query: 1 GDVAEVNRCLAAGEPVDKRDTKRKTPLHCACAGGHYAVVNVLLER 135 GD+ + + L G+ V+KRD +++TPLH AC GH +V+ L+ER Sbjct: 59 GDIWNMEQLLLRGKNVNKRDKRKRTPLHLACTIGHADMVDFLVER 103
BLAST of mRNA_H-paniculata_contig10731.463.1 vs. uniprot
Match: M3XP97_MUSPF (Uncharacterized protein n=1 Tax=Mustela putorius furo TaxID=9669 RepID=M3XP97_MUSPF) HSP 1 Score: 47.0 bits (110), Expect = 3.540e-5 Identity = 19/45 (42.22%), Postives = 31/45 (68.89%), Query Frame = 1 Query: 1 GDVAEVNRCLAAGEPVDKRDTKRKTPLHCACAGGHYAVVNVLLER 135 G++ + + L G+ V+KRD +++TPLH AC GH +V+ L+ER Sbjct: 59 GNIWNMEQLLLRGKNVNKRDKRKRTPLHVACTIGHADMVDFLVER 103
BLAST of mRNA_H-paniculata_contig10731.463.1 vs. uniprot
Match: UPI00138724A9 (putative ankyrin repeat domain-containing protein 19 n=1 Tax=Mustela erminea TaxID=36723 RepID=UPI00138724A9) HSP 1 Score: 47.8 bits (112), Expect = 5.590e-5 Identity = 19/45 (42.22%), Postives = 31/45 (68.89%), Query Frame = 1 Query: 1 GDVAEVNRCLAAGEPVDKRDTKRKTPLHCACAGGHYAVVNVLLER 135 GD+ + + L G+ ++KRD +++TPLH AC GH +V+ L+ER Sbjct: 37 GDIWNMEQLLLRGKNMNKRDKRKRTPLHLACTIGHADMVDFLVER 81 The following BLAST results are available for this feature:
BLAST of mRNA_H-paniculata_contig10731.463.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 9
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_H-paniculata_contig10731.463.1 >prot_H-paniculata_contig10731.463.1 ID=prot_H-paniculata_contig10731.463.1|Name=mRNA_H-paniculata_contig10731.463.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=polypeptide|length=46bp GDVAEVNRCLAAGEPVDKRDTKRKTPLHCACAGGHYAVVNVLLER*back to top mRNA from alignment at H-paniculata_contig10731:1123..1260+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_H-paniculata_contig10731.463.1 ID=mRNA_H-paniculata_contig10731.463.1|Name=mRNA_H-paniculata_contig10731.463.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=mRNA|length=138bp|location=Sequence derived from alignment at H-paniculata_contig10731:1123..1260+ (Halopteris paniculata Hal_grac_a_UBK monoicous)back to top Coding sequence (CDS) from alignment at H-paniculata_contig10731:1123..1260+ >mRNA_H-paniculata_contig10731.463.1 ID=mRNA_H-paniculata_contig10731.463.1|Name=mRNA_H-paniculata_contig10731.463.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=CDS|length=276bp|location=Sequence derived from alignment at H-paniculata_contig10731:1123..1260+ (Halopteris paniculata Hal_grac_a_UBK monoicous)back to top |